Entry information : CheKat03_C4 (CAT3)
Entry ID 5390
Creation 2007-05-18 (Christophe Dunand)
Last sequence changes 2007-05-18 (Christophe Dunand)
Sequence status complete
Reviewer Marcel Zamocky
Last annotation changes 2012-04-23 (Catherine Mathe (Scipio))
Peroxidase information: CheKat03_C4 (CAT3)
Name (synonym) CheKat03_C4 (CAT3)
Class Catalase    [Orthogroup: Kat001]
Taxonomy Eukaryota Fungi Ascomycota Dothideomycetes Pleosporaceae Cochliobolus
Organism Cochliobolus heterostrophus    [TaxId: 5016 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value CheKat03_C4
start..stop
S start..stop
CheKat03_C5 1511 0 1..730 1..730
PnoKat03 1077 0 5..725 3..720
PEchKat03 975 0 5..729 2..729
AnKat02 937 0 9..729 5..725
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 626943..627219 277 N° 2 627273..627509 237 N° 3 627558..627747 190 N° 4 627810..627845 36
N° 5 627901..628090 190 N° 6 628145..628309 165 N° 7 628365..629462 1098  
join(626943..627219,627273..627509,627558..627747,627810..627845,627901..628090, 628145..628309,628365..629462)


exon

Literature and cross-references CheKat03_C4 (CAT3)
Literature Robbertse,B., Yoder,O.C., Nguyen,A., Schoch,C.L. and Turgeon,B.G. Deletion of all Cochliobolus heterostrophus monofunctional catalase-encoding genes reveals a role for one in sensitivity to oxidative stress but none with a role in virulence. Mol. Plant Microbe Interact. 16 (11), 1013-1021 (2003)
Protein ref. UniProtKB:   Q6UJ32
DNA ref. JGI genome:   scaffold_14 (626943..629462)
Protein sequence: CheKat03_C4 (CAT3)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   730 (711)
PWM (Da):   %s   79694.99 (77737.0)  
PI (pH):   %s   6.43 (6.22) Peptide Signal:   %s   cut: 20 range:20-730
Sequence 771
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MVRSNVLTAIAAICHVAHAVCPYMDDQPLARREGATAMSTDDFMKQYEIDDSKAYLTSPVGGPQPDQESLSAGERGPSLLEDQILRRKIMSFDHERVPERAVHARGAGAHGTFKSYGDWSNITGASFLANSEKETPVFIRFSTVAGSRGSADTARDVHGFAVRFYTDEGNFDIVGNNIPVFFIQDAIKFPDLIHAVKPKPDREIPQAATAHDSAWDFFSQQPSTMHTLLWAMSGHGTIRSYRHTDGWGVHTFRFVRDDGKSKLVKFRFRSLQGKASLLWEEAQTTAGMNADMHRQDLFESIENGYYPEWIFEAQIMEESDQLRFGFDVLDPTKIVPEDIVPFTPLGKLTLNRNPRNYFAETEQIMFQPGHLVRGIDVSDDPLLQGRMFSYLDTQLNRNGGPNFEQIPINQPRVPVHNNERDGAGQMYIPLNTAAYSPNTLNGGYPKQATQAEGRGFFTAPSRSVSGNLVRTVSSTFADNWSQPRLFYNSLSAVEQQFVINAIRFETSQLQSEVVKQNVLIQLNRISHDIATRVATALGMTAPAPDDKFYHNNKTIGVNPAGEPLLKIEGLKVGYLTSAGSTGDKGKALKAALKDEKVSLTVVAEHLGAGIDQTYSATSAVNFDAIIVDGSASALFAPAGSLANSNSTAAKGRSTLYPAGRPLEILQTGYQFGKPVGVLGASNSTLSAAGVVAGTPGVYSFDSASDMAAVVTKITEGLRTFKFLDRYPLDN

Retrieve as FASTA  
Remarks Complete sequence from genomic (6 intron). Strain="C4/ATCC 48331".
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
TGGTACGGTCTAACGTTTTGACAGCAATTGCTGCTATTTGCCATGTCGCTCACGCTGTTTGCCCCTACATGGATGACCAACCACTCGCCCGCCGCGAGGGTGCCACTGCCATGTCAACTG
ATGATTTCATGAAGCAGTATGAGATTGACGACAGCAAGGCCTACCTCACGAGTCCTGTGGGAGGGCCCCAACCCGACCAAGAGAGCCTCTCGGCTGGTGAGCGAGGTCCATCACTGCTCG
AGGATCAAATTCTCCGCCGGAAAATCATGAGCTTTG
GTAAGAGTAATAGAAATCTCCGCATCTGACGGTTTAATAACCTAGCCGTTTAGATCACGAGCGTGTTCCTGAGCGCGCCGTGCA
CGCCCGTGGTGCCGGTGCTCATGGAACGTTCAAGTCATATGGTGACTGGTCTAATATTACCGGAGCCTCCTTCCTTGCCAACTCTGAGAAGGAAACCCCAGTTTTCATTCGATTCTCTAC
TGTTGCAGGAAGCCGTGGCTCCGCCGATACTGCCCGAGATGTTCATGGCTTTGCTGTCAGGTTCTACACCGACGAAGGCAACTTTG
GTAAGCCCCATAATGACGACACACAGATGCGGTA
TTAACAGTCTCTAGATATTGTCGGTAACAACATTCCTGTTTTCTTTATCCAGGATGCCATCAAGTTCCCTGATCTCATCCACGCTGTCAAGCCCAAGCCGGACCGTGAGATTCCTCAGGC
AGCAACGGCTCACGATTCGGCATGGGACTTCTTCAGTCAGCAGCCTAGCACCATGCACACCCTCCTGTGGGCTATGAGTGGACA
GTGAGTGAATATGTAAAATGTTTGAGCAGGACGATT
ACTAACAAGTTTTTTCTTTCTTGCAGTGGTACCATTCGTTCCTACAGGCATACCGATGGCTGGTAAGAACAACCTTTCTCATGTTTAGATGAACAATGTACTAACTCATCTGTCTAGGGG
TGTACACACTTTCCGCTTTGTCCGTGACGACGGCAAGTCCAAGCTCGTCAAGTTCCGCTTCCGATCTCTCCAGGGTAAGGCCTCCCTGTTGTGGGAAGAGGCTCAAACCACTGCCGGAAT
GAACGCGGATATGCACCGACAGGATCTCTTCGAGAGCATCGAGAACGGCTACTACCCAGAATGGATC
GTACGTACCCCTAGTCTATCCAAAGACGATGATTGCTAACCTTTTGGTGTTTA
GTTTGAGGCCCAAATCATGGAGGAGTCGGACCAACTTCGATTCGGATTCGACGTTCTCGACCCCACCAAGATTGTTCCCGAAGACATTGTTCCTTTCACCCCTCTTGGAAAGTTGACCTT
GAACCGCAACCCTCGCAACTACTTTGCCGAGACTGAGCAAATTATG
GTATGTTCCGGTGCCACCTTGATGGGGTGTCTGAATGCTTACTTTGTGTCTCTAGTTCCAACCTGGTCATCTCG
TCCGCGGTATTGATGTTTCCGACGACCCGCTCCTTCAAGGACGCATGTTCTCGTACTTGGACACTCAGTTGAACCGCAACGGTGGTCCCAACTTTGAACAGATCCCTATCAACCAGCCCC
GTGTTCCCGTCCACAACAACGAGCGTGATGGTGCCGGCCAAATGTATATTCCTCTCAACACTGCCGCCTACTCGCCCAACACCTTGAACGGTGGTTACCCCAAGCAAGCCACCCAGGCCG
AAGGTCGCGGGTTCTTCACAGCACCCTCTCGATCCGTCAGCGGAAACCTTGTCCGCACCGTCTCCAGCACCTTTGCCGACAACTGGTCGCAGCCTCGTCTGTTCTACAATTCCTTGTCCG
CAGTCGAGCAGCAGTTTGTCATCAATGCCATCCGATTTGAGACTTCGCAACTCCAGAGCGAGGTTGTCAAGCAGAACGTCTTGATCCAGCTTAACCGTATCAGCCACGACATTGCTACCC
GTGTTGCTACTGCTCTTGGCATGACTGCACCCGCACCTGATGACAAGTTCTACCACAATAACAAGACGATTGGTGTTAACCCGGCTGGCGAGCCCCTGCTCAAGATCGAGGGCTTGAAGG
TTGGATACCTTACCTCTGCGGGATCCACTGGCGACAAGGGCAAGGCGCTCAAGGCCGCGCTCAAGGACGAGAAGGTTAGCTTGACGGTAGTCGCTGAGCACCTTGGCGCTGGCATTGACC
AGACCTACTCTGCTACTTCGGCCGTTAACTTTGACGCCATCATCGTTGATGGTAGCGCTTCAGCCCTCTTCGCCCCCGCGGGCAGCCTCGCCAACTCCAACTCCACGGCTGCCAAGGGCC
GTTCCACTTTGTACCCTGCTGGTCGCCCTCTCGAGATCCTCCAGACCGGTTACCAGTTTGGCAAGCCCGTTGGTGTTCTCGGAGCCAGCAACTCGACTCTATCTGCTGCTGGTGTTGTGG
CCGGCACCCCTGGTGTTTACAGCTTCGACTCCGCCAGCGACATGGCGGCAGTTGTTACCAAGATCACTGAGGGTCTGCGCACTTTCAAGTTCCTTGACAGGTACCCATTGGACAACTAG

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
TGGTACGGTCTAACGTTTTGACAGCAATTGCTGCTATTTGCCATGTCGCTCACGCTGTTTGCCCCTACATGGATGACCAACCACTCGCCCGCCGCGAGGGTGCCACTGCCATGTCAACTG
ATGATTTCATGAAGCAGTATGAGATTGACGACAGCAAGGCCTACCTCACGAGTCCTGTGGGAGGGCCCCAACCCGACCAAGAGAGCCTCTCGGCTGGTGAGCGAGGTCCATCACTGCTCG
AGGATCAAATTCTCCGCCGGAAAATCATGAGCTTTG
ATCACGAGCGTGTTCCTGAGCGCGCCGTGCACGCCCGTGGTGCCGGTGCTCATGGAACGTTCAAGTCATATGGTGACTGGTCTA
ATATTACCGGAGCCTCCTTCCTTGCCAACTCTGAGAAGGAAACCCCAGTTTTCATTCGATTCTCTACTGTTGCAGGAAGCCGTGGCTCCGCCGATACTGCCCGAGATGTTCATGGCTTTG
CTGTCAGGTTCTACACCGACGAAGGCAACTTTG
ATATTGTCGGTAACAACATTCCTGTTTTCTTTATCCAGGATGCCATCAAGTTCCCTGATCTCATCCACGCTGTCAAGCCCAAGCCGG
ACCGTGAGATTCCTCAGGCAGCAACGGCTCACGATTCGGCATGGGACTTCTTCAGTCAGCAGCCTAGCACCATGCACACCCTCCTGTGGGCTATGAGTGGACA
TGGTACCATTCGTTCCT
ACAGGCATACCGATGGCTG
GGGTGTACACACTTTCCGCTTTGTCCGTGACGACGGCAAGTCCAAGCTCGTCAAGTTCCGCTTCCGATCTCTCCAGGGTAAGGCCTCCCTGTTGTGGGAAG
AGGCTCAAACCACTGCCGGAATGAACGCGGATATGCACCGACAGGATCTCTTCGAGAGCATCGAGAACGGCTACTACCCAGAATGGATC
TTTGAGGCCCAAATCATGGAGGAGTCGGACC
AACTTCGATTCGGATTCGACGTTCTCGACCCCACCAAGATTGTTCCCGAAGACATTGTTCCTTTCACCCCTCTTGGAAAGTTGACCTTGAACCGCAACCCTCGCAACTACTTTGCCGAGA
CTGAGCAAATTATG
TTCCAACCTGGTCATCTCGTCCGCGGTATTGATGTTTCCGACGACCCGCTCCTTCAAGGACGCATGTTCTCGTACTTGGACACTCAGTTGAACCGCAACGGTGGTC
CCAACTTTGAACAGATCCCTATCAACCAGCCCCGTGTTCCCGTCCACAACAACGAGCGTGATGGTGCCGGCCAAATGTATATTCCTCTCAACACTGCCGCCTACTCGCCCAACACCTTGA
ACGGTGGTTACCCCAAGCAAGCCACCCAGGCCGAAGGTCGCGGGTTCTTCACAGCACCCTCTCGATCCGTCAGCGGAAACCTTGTCCGCACCGTCTCCAGCACCTTTGCCGACAACTGGT
CGCAGCCTCGTCTGTTCTACAATTCCTTGTCCGCAGTCGAGCAGCAGTTTGTCATCAATGCCATCCGATTTGAGACTTCGCAACTCCAGAGCGAGGTTGTCAAGCAGAACGTCTTGATCC
AGCTTAACCGTATCAGCCACGACATTGCTACCCGTGTTGCTACTGCTCTTGGCATGACTGCACCCGCACCTGATGACAAGTTCTACCACAATAACAAGACGATTGGTGTTAACCCGGCTG
GCGAGCCCCTGCTCAAGATCGAGGGCTTGAAGGTTGGATACCTTACCTCTGCGGGATCCACTGGCGACAAGGGCAAGGCGCTCAAGGCCGCGCTCAAGGACGAGAAGGTTAGCTTGACGG
TAGTCGCTGAGCACCTTGGCGCTGGCATTGACCAGACCTACTCTGCTACTTCGGCCGTTAACTTTGACGCCATCATCGTTGATGGTAGCGCTTCAGCCCTCTTCGCCCCCGCGGGCAGCC
TCGCCAACTCCAACTCCACGGCTGCCAAGGGCCGTTCCACTTTGTACCCTGCTGGTCGCCCTCTCGAGATCCTCCAGACCGGTTACCAGTTTGGCAAGCCCGTTGGTGTTCTCGGAGCCA
GCAACTCGACTCTATCTGCTGCTGGTGTTGTGGCCGGCACCCCTGGTGTTTACAGCTTCGACTCCGCCAGCGACATGGCGGCAGTTGTTACCAAGATCACTGAGGGTCTGCGCACTTTCA
AGTTCCTTGACAGGTACCCATTGGACAACTAG

Retrieve as FASTA