Entry information : GmPrx46 (Glyma09g41440.1)
Entry ID 540
Creation 2005-06-21 (Christophe Dunand)
Last sequence changes 2011-10-10 (Qiang Li)
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2011-12-13 (Qiang Li)
Peroxidase information: GmPrx46 (Glyma09g41440.1)
Name (synonym) GmPrx46 (Glyma09g41440.1)
Class Class III peroxidase    [Orthogroup: Prx012]
Taxonomy Eukaryota Viridiplantae Streptophyta Fabaceae Glycine
Organism Glycine max (soybean)    [TaxId: 3847 ]
Cellular localisation N/D
Tissue type Roots
Inducer Sudden Death Syndrome disease
Repressor N/D
Best BLASTp hits
Perox score E-value GmPrx46
start..stop
S start..stop
GmPrx44 633 0 1..322 1..322
PcoPrx01 550 0 1..322 1..321
GmPrx188 504 0 8..322 1..316
GmPrx52 501 0 8..322 1..316
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 46114550..46114777 228 N° 2 46113899..46114090 192 N° 3 46113607..46113772 166 N° 4 46112522..46112904 383
complement(join(46112522..46112904,46113607..46113772,46113899..46114090,4611455 0..46114777))


exon

Literature and cross-references GmPrx46 (Glyma09g41440.1)
Literature Public Soybean EST Project.
DNA ref. Phytozome 12:   Gm09 (46114777..46112522)
Protein sequence: GmPrx46 (Glyma09g41440.1)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   322 (293)
PWM (Da):   %s   34079.39 (30816.8)  
PI (pH):   %s   4.85 (4.60) Peptide Signal:   %s   cut: 30 range:30-322
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MASSCFSMTTPIFKIRFFLFLCFIGISSSQLSSDFYSTTCPNALSTIKSAVDSAVSNEARMGASLLRLHFHDCFVQGCDASVLLNDTSSFTGEQTAAGNVNSIRGFGVIDNIKSQVESLCPGVVSCADILTVAARDSVVALGGPSWTVQLGRRDSTTASLSSANSDLPRFDLSLQQLSDNFQNKGLTTAEMVALSGGHTIGQAKCSTFRTRIYNETNIDSSFATSLQANCPSVGGDSNLAPLDSSQNTFDNAYFKDLQSQKGLLHTDQVLFNGGSTDSQVNGYASDPSSFNTDFANAMVKMGNISPLTGSSGEIRTNCWKTN

Retrieve as FASTA  
Remarks Complete sequence from genomic and 11 ESTs.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTAGTAGTTGTTTCTCCATGACAACACCAATCTTCAAAATTCGCTTCTTCTTATTCTTATGCTTTATTGGGATAAGTTCATCTCAATTGTCCTCTGACTTTTACTCCACAACTTGT
CCTAATGCGCTTTCAACCATTAAGAGTGCAGTGGATTCTGCTGTGAGCAATGAGGCTCGCATGGGGGCTTCCCTCCTACGTCTTCATTTCCATGATTGTTTTGTTCAA
GCAAGTCAACTT
ACCCAGCTTCATCAATCTTCTTTCATTACTTCAAATTTCATGTTCATCGTGCATCTGCACACACACATGCATACATGTTTATCACGAATAATACACAAGAAAATTTTCTTCAATTACGTG
GCAGTGCTATATAGTTTACTTTTTTATTTGACAAATACTATATCAATTCAAACAAATTAAACTCAATTCCTAACTGTTAATACATGACATTTTTTAGTGACAATATGAACATCTAATTTT
CCGTTAGCATTTGTTTAATTCCCTAGTGGCCAGCAAAAGAGACCAAGTCAATATCCTTTTTTAAATCATTATTCAGAAAAAGAAAACTTGACATTGACAATCATATTCACGTGTGTTGCT
AATAACTAACTAATGTTAAATGAGGCTAGTTAAACGACTCATTCTATTAATCACCAAATAATTTGTACGTGTTTAATTTAATTTCAGGGATGTGATGCATCAGTGCTATTGAATGATACA
TCAAGTTTCACAGGTGAACAGACGGCAGCTGGCAACGTTAATTCCATAAGGGGTTTTGGTGTAATAGACAACATCAAGTCTCAAGTTGAGAGCTTATGTCCTGGTGTTGTTTCTTGTGCT
GATATTCTCACTGTAGCTGCAAGGGACTCTGTTGTTGCT
GTAAGTATNNNNNNNNNNNNNNNNNNNNNNNCAAAACGCTACACAATAATTAACATAAAACCCATATATAATGAGTTACTC
CTAGCTAGGTACTAATAATTTATTGAAATATGATCTATCTCTTAGCTTGGTGGACCTAGTTGGACAGTGCAATTGGGCAGAAGAGACTCAACCACTGCAAGTTTAAGTTCTGCAAACTCA
GACTTGCCCCGTTTTGATTTAAGTCTGCAACAACTCAGCGATAATTTCCAAAACAAAGGTCTCACCACCGCAGAAATGGTTGCTCTCTCAG
GTAATTAATAATTGACTACCCGCTAAATG
CATGTTGAATTATTAAGGATTTACTACCCTCTGGACCTAAATATAAACAACAACTGAATATATTTTTTAAACTCAAATATAAGAAAATTTTAACTATTTTAACCCCATGTAATAATATCA
TTGCAAGAATATCCTTCCATTGTGATTATAATTTCAATTACTCCTTTTTATTCTTAATATCAAGTTCTAATAAATGACACTTTAGAAAATAATTTTTTTAAATCATTAAAAGAATTAAAT
AAAATTAACCAACTTTATTAATCCATGGATAAGTTACTTAAAACATAACATTTATTTCATGTTAATTCGATTAACTACCTAATGCATGAATCAACTGGTAAGTTTGTGTGTGTGATTGTC
TTAGACCATGGTGGTCCTAATCAATATCTGTGTGATTCAAATTTATTTTTCTCACCCTAATATTTATCTATGTAACACAATCAAGTCTTATTAACTCTTTTTTATAAACTAAAAAATTTA
ATTATGTATCATATGAAGATTGATTAAGACAATAACACGTGGTGATATTGATTTTTCCATTAATAAGAGGAGATAGGAGAGATATGATGCCATTAGACCAGGTCACCCAAATGATGAAAT
GAAAAATTGTATATTTATAATTACTTTTACAATGTACTATATGTTCTTCTAATATTTGTAATATATATTTCAGGAGGGCACACAATTGGGCAAGCTAAATGTTCAACTTTCAGAACAAGG
ATTTACAACGAGACCAACATAGATTCCTCTTTTGCAACATCATTGCAGGCAAATTGTCCAAGCGTGGGTGGTGACAGCAATTTGGCCCCTCTTGACAGCAGCCAAAACACCTTTGACAAT
GCTTACTTCAAGGATTTGCAGAGCCAAAAGGGTCTCTTGCACACAGATCAAGTGCTTTTCAATGGAGGATCCACAGACTCTCAAGTAAATGGTTATGCCAGCGACCCTTCAAGCTTCAAC
ACTGACTTTGCCAATGCAATGGTTAAAATGGGAAACATTAGCCCACTTACTGGCTCTAGTGGCGAAATCAGGACCAATTGTTGGAAGACCAATTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTAGTAGTTGTTTCTCCATGACAACACCAATCTTCAAAATTCGCTTCTTCTTATTCTTATGCTTTATTGGGATAAGTTCATCTCAATTGTCCTCTGACTTTTACTCCACAACTTGT
CCTAATGCGCTTTCAACCATTAAGAGTGCAGTGGATTCTGCTGTGAGCAATGAGGCTCGCATGGGGGCTTCCCTCCTACGTCTTCATTTCCATGATTGTTTTGTTCAA
GGATGTGATGCA
TCAGTGCTATTGAATGATACATCAAGTTTCACAGGTGAACAGACGGCAGCTGGCAACGTTAATTCCATAAGGGGTTTTGGTGTAATAGACAACATCAAGTCTCAAGTTGAGAGCTTATGT
CCTGGTGTTGTTTCTTGTGCTGATATTCTCACTGTAGCTGCAAGGGACTCTGTTGTTGCT
CTTGGTGGACCTAGTTGGACAGTGCAATTGGGCAGAAGAGACTCAACCACTGCAAGTTTA
AGTTCTGCAAACTCAGACTTGCCCCGTTTTGATTTAAGTCTGCAACAACTCAGCGATAATTTCCAAAACAAAGGTCTCACCACCGCAGAAATGGTTGCTCTCTCAG
GAGGGCACACAATT
GGGCAAGCTAAATGTTCAACTTTCAGAACAAGGATTTACAACGAGACCAACATAGATTCCTCTTTTGCAACATCATTGCAGGCAAATTGTCCAAGCGTGGGTGGTGACAGCAATTTGGCC
CCTCTTGACAGCAGCCAAAACACCTTTGACAATGCTTACTTCAAGGATTTGCAGAGCCAAAAGGGTCTCTTGCACACAGATCAAGTGCTTTTCAATGGAGGATCCACAGACTCTCAAGTA
AATGGTTATGCCAGCGACCCTTCAAGCTTCAACACTGACTTTGCCAATGCAATGGTTAAAATGGGAAACATTAGCCCACTTACTGGCTCTAGTGGCGAAATCAGGACCAATTGTTGGAAG
ACCAATTAA

Retrieve as FASTA