Entry information : GmPrx48 (Glyma09g00480)
Entry ID 543
Creation 2005-11-09 (Christophe Dunand)
Last sequence changes 2014-04-10 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2014-04-10 (Christophe Dunand)
Peroxidase information: GmPrx48 (Glyma09g00480)
Name (synonym) GmPrx48 (Glyma09g00480)
Class Class III peroxidase    [Orthogroup: Prx019]
Taxonomy Eukaryota Viridiplantae Streptophyta Fabaceae Glycine
Organism Glycine max (soybean)    [TaxId: 3847 ]
Cellular localisation N/D
Tissue types Globular embryos
Immature seed coats
Mature flowers
Roots
Seeds
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value GmPrx48
start..stop
S start..stop
GmPrx231 633 0 17..342 15..339
PvPrx17 571 0 18..333 20..335
MtPrx94 553 0 23..342 96..413
LjPrx33 550 0 17..342 22..347
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 213552..213767 216 N° 2 213285..213476 192 N° 3 210876..211496 621  
complement(join(210876..211496,213285..213476,213552..213767))


exon

Literature and cross-references GmPrx48 (Glyma09g00480)
Literature Public Soybean EST Project.
DNA ref. Phytozome 12:   Gm09 (213767..210876)
Protein sequence: GmPrx48 (Glyma09g00480)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   343 (318)
PWM (Da):   %s   38165 (35272.5) Transmb domain:   %s   i7-24o
PI (pH):   %s   7.31 (7.68) Peptide Signal:   %s   cut: 25 range:25-342
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MSMNMNMALFLMFLVLHIAWLVASSDLRAGFYSKTCPKAEVIVRDVMKKALMREARSVASVMRFQFHDCFVNGCDGSMLLDDTATMLGEKMALSNINSLRSYKVVDQVKQALEKDCPGVVSCADIIIMASRDAVALTGGPEWEVRLGRLDSLSASQEDSNNIMPSPRANASSLIDLFQKYNLSVKDLVALSGSHSIGQGRCFSIMFRLYNQSGTGRPDPAIDPSYRQELNRICPLDVDQNVTGNLDSTPLVFDNQYFKDLVAGRGFLNSDQTLFTSPHTREFVRLFSRRQTEFFKAFVEGMLKMGDLQSGRPGEVRTNCRFVNARPANLLLQSPRDMESNDK*

Retrieve as FASTA  
Remarks Complete sequence from genomic (introns 1 and 2) and 46 ESTs.
Promoter
Send to BLAST
Send to cis Analysis
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
AAAAAATTAC TCCATCCATA TCGCTCTTAA AAAAGTTAAC AAATATAATT TCGATAACAT AAAATATAAT AATATCAAAT AAAAAATATT AAATTAATAT TTTTATTTTG TTTGTTATAA  ATATATATAA TTTGTTTTTA GATTTTATAT TTTATTTTGT TTCACAAATA AAACTTTTTT TTTTACTTAG CCTAATCTCT AAGTGTTTTA GGTCTTTTTA CATTAGACGA TAACACATGT  TATTTGTTTT AAGAAAAAAA AATTAAATTT CTAAAAACAC AATTTAATCC CCCCTTCTTA TGTTATTTGC TTATATACAA ATTCTATGAG AATATTTTTT GCATTAAAAA ATCTTAAACA  CAAATTATTA GATGAAAGTC TTAAATGTAT TATTTAAATG TTATGTTAAA TCGTCTTAGG AATGTATTGT TTAAAAATAA AGATGCATCA ATACATATTA TGATCGGATA GTATATCAGA  CACAATATTT ATCATTTATA TTTATTTACA TCTAATCAAA ATAATTAAGA GTTTTGATTC ATTTTTAAAA TATAAATATC TTTTAACTTA ACATATATAA CACTTAAGAA AGATAAAAAA  AAAAAAAAAA AAACCTTACC CTATATGCTA TTCTCTTTCA TGCTCACATG AACCCACCCC AAACGACGAT GTCACTAGCA CAACACCCTT GTCATCAATA ACATTTATTA AGTAAGAAAA  TATTAATATA TTTAAATTAT TTTATAAAAT AATATTTACA CATGCATGAC TCAAGTCATC TACTCTAGTT AATAGCATAT AAGATAATAG TTTCATTTGG TAGAAGATTT GATTTGGAAC  CTTATAAAAT ATTGTTAGTA ATATCAGATT TAACATTTTC ATTAAATGAC AAAATTTGTA GGAGGAATGT AAAAATAAGA GGGACAAAGA ATACAAGTCA AAAAATATGA TTATGTATAT  ACTAATAGTT TACGTATAAC ATGAGACTTG ATTGAAAATT TAAAAGTATT TTTAGAGATG AAATAGTATT TGATTAAGTT TGGAGACCAA AATGTTTCAA TAAATAATTT ATTAAGTTCA  AAGTCTAAAT TAAAAATATA ACTAACAATT ATCAAGTATC ACATCATCAC CGATGATGAC ATGTAGGTAC GCAAGTTAAG GATGACAAAA AAAAATAATG ATATAAATAA TTTATTGTAC  TTTTTACCCA TTTAAGAATT ACATTCAATT TTTTTATTTT CATGAAGTCA ATATGTTAGT GTTTTACACT TTTAAATATT AAAATTAATA TTTATCTTTA AATTTAATTG TATCAATTAA  AACAAAGTAT TTATTACAAA TTATACCTTT TATTAACATT TATATTGTTA TAAATAAAAT TTTGTAACAA TAGTCCTTTT TATTCAAATA CTGATGATTT TTACTTTCAA TTTTTAACAC  AAAAAATTGA GCAACACGAA AAACAAAAAA CCACGCCCCT ACATGAAGGC AACAATTATG GCACTATGGC CGAAAAAAAA TCACGGCAAC ACCCATACCT GAATGCCCAC TTTATCTATA  TCTAACATAC TGCAGTGAAA TAAAACATTT TTGCTTAAAT TAATCTTTTG GTACTATTAT ATAAAATAAA AAAAAGTAAG AATCACAAAA TGAGAGAGTA ATTTAACTCA TATTTTACTT  TAATGGCATT GAATGCGACT TATACAACCG GTAACCATTA TGGATGCTGG CCCTCGGATT CAAAAAGAAA CTTATCTAAC GGCCGAGGGT ACTTTCCCAA AATGGGAGAC ATGTCCAGCC  GACGCCTTAT TTCATTCCTA TAAAAGTGAG AAACCGTGTT CTCTAAGTCA GACGATATTC CAAAAACGAT TTTATTAATT GTTAAAATGA AAAAAAGAAT TACTTTATCC ACCTCCAAAG 
TGAGTTAGTA GTTGATACTA ACCATATATA GCCACACTCC TCAGCTACTC TGATCAAAAC AAGGGGACAT CTTTGTTTGT G 

Retrieve as FASTA  
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGAGCATGAACATGAACATGGCTCTGTTTCTGATGTTCCTTGTTCTGCACATAGCTTGGCTTGTAGCATCATCGGATCTCCGAGCTGGCTTTTACTCAAAAACATGTCCAAAAGCGGAA
GTCATAGTCCGAGATGTGATGAAGAAAGCCCTTATGAGGGAAGCCAGAAGTGTTGCCTCTGTCATGCGCTTCCAGTTCCATGATTGCTTTGTGAAT
GTAGGTGCTAGTAATTGAATTGAT
TTGAATTGAATTGAATTTGATTTGATTTGAATTTGAATTTGATTTGTGAAGGGGTGTGATGGGTCTATGTTGCTTGATGACACAGCAACGATGCTTGGGGAGAAAATGGCCCTCTCAAAT
ATAAATTCGCTGAGATCATATAAAGTTGTTGATCAAGTCAAGCAAGCGCTCGAGAAGGACTGCCCAGGAGTGGTTTCCTGTGCTGACATCATAATCATGGCTTCCAGAGATGCTGTCGCT
CTG
GTTCGTTCCTTCCTTCCTTCCCTCATACTTAAGATGATCATAGTTACAAAATATTATTTTGACACCCCTAGACTACCACTCAGAACCCGAATCACATTAAAATAAAAGAGAAGAAAA
CCAACAAAACATTGAGAGACTAGGTTACAACAAATAATAACAAAGAATCAAAAAATGGGTTAGCAAAACATATAACTAGGTACATATGATCTGTTCTGAAAGTCTTTCCAAAATAAAAGA
CAGTACAAGATCCCACCAACAAAAAAGAGAACTCGAGTTTGCCACAAAATTGGCCAACTTTTTGGCGCAAAAATTTCCTAAAATTGAAAAATTCTTGCAAAGATTAATAAGTATTGTTAT
TATTTTTTTTAATATCTTCTTATTAATTTGCTTAAGCATTTTATGAAGAAAGCATGAAATGAAAAATTAAATGCCTTTCTTATTTTTCAAGAAGTTTGGTAAAATATCTTCTTTTTAAAG
TGTATCTGATACTATTTCAAATCATATAATAATGAGTGCAGTATATTACAGCAACAATATTTAGAGTAGTAGAATCTTTATTGGTCCATCTTAATCTTAAACTGTATGCCTAACCACACC
TGATTCATTTTATATAAAAGTTTATTTTTAAAATGCTTGGTACATTTATGGATATTATAGATAATAAATCTGATGTGATTAGATATATGATTTAAAACTAAGATTGACCATTAAAAGTTT
TACTGATTCAAATACTACTCTAATATAACGGAGATGATCTACATTTATGCAGTAGTATTCTTCGGTTTCTTTTCACATTTCATTTTGTGTAATTGCACAAGGATTAAGTAAACAATTAAT
GAGTCAACCAGGTCCACTGCACGTGTATTATGGAAAATTTGTTCGAAATTCAATTTTAAATGCCACTGTTCCCCCCGCTAGAATTTAATGTGATGTACTGTTAGGCCAAATGTTTATACT
AGCATTTATTGTTGTGTTACTGCATCATTTAATGGATTAATTATTAACATATTAAATGCATAGACAGTTTTCCTTTTTCTACCAAAAAAGAAATGCATTGACAGTTTTTTTAATATTAAC
AATGCATTATAATTAAATTTTTTACTTATAAATTTATATTTAAGTTGTTAAGTGGTTATTTTTTTGGGTTCTGAATTTGGAGTTAAGCCTTTTAATTATTTTTTTAAAATATATTTTTAT
TCCTTCAAAATTAAATCATTTTCTTTTTAGTCATTCAAATTTAAAGTTATTTTTTTAATCCTTCAAATTCATAAAATAACCTTTTTAATCCTACCGGCCAAACATAAAAAAAAATTCACA
ATTTATAACAACTTTTCATTGCCAAAATTTGTTTATCATTCTATATTTTAAACTATGTTTCTCACAGTTAAAAATTGACATGATCAAGTCAGGATAAAAAATTAAAAATTCATTAACCAC
TTTAAAAATTGTTTTAATTTTTTTATTGAGTTGATTATTGACAATCAAATATAAAAATAGAAAATCAAATTATAAGGGTCAAAAATTGTGAATCTCTTCTTTTTTGTTTGGCTCACAATT
TACAAAAGGACTAAAAAATATTTTATAGATTTTAGGGAATAAAAAAATAACTTTAAATTTAGAGGACTAAAAAAAAATCTCACATAGAAGACTAAAAAACATATTTAAACTTTTTTTGTT
TTTAACAACCAATTGATAATTAATACTGTTAAAGTGTTCAAAATATGCTTTTAAGGTAAATTATGCTAACCATTCTTTAGCCTTTTGGTATAGTAATGACTTGCATTGCAGACAGGTGGA
CCCGAGTGGGAGGTGAGGTTGGGAAGATTGGACAGCTTGAGTGCGAGTCAAGAAGACTCAAACAACATCATGCCGAGCCCAAGAGCCAACGCAAGCTCTCTTATTGATCTCTTCCAGAAA
TATAACCTCAGCGTGAAAGACCTTGTAGCACTCTCAGGATCTCACTCTATTGGCCAAGGTCGTTGTTTCTCCATCATGTTTAGGCTATACAATCAATCTGGAACTGGAAGGCCTGATCCT
GCCATTGATCCTAGCTATAGGCAAGAGCTTAACAGGATATGTCCACTGGATGTTGACCAAAATGTCACTGGGAACCTTGATTCCACGCCTCTCGTCTTTGATAACCAATATTTCAAGGAT
TTGGTTGCTGGGAGGGGCTTTCTCAACTCTGATCAAACACTCTTCACATCCCCTCACACAAGGGAGTTTGTGAGGTTATTTAGTAGACGCCAAACTGAGTTTTTCAAAGCATTTGTCGAA
GGAATGTTGAAGATGGGTGACTTGCAGTCTGGTCGTCCTGGGGAAGTTAGGACTAATTGCCGGTTCGTCAACGCTCGCCCGGCTAATTTGCTGCTTCAGTCTCCACGCGACATGGAGAGT
AACGATAAATAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGAGCATGAACATGAACATGGCTCTGTTTCTGATGTTCCTTGTTCTGCACATAGCTTGGCTTGTAGCATCATCGGATCTCCGAGCTGGCTTTTACTCAAAAACATGTCCAAAAGCGGAA
GTCATAGTCCGAGATGTGATGAAGAAAGCCCTTATGAGGGAAGCCAGAAGTGTTGCCTCTGTCATGCGCTTCCAGTTCCATGATTGCTTTGTGAAT
GGGTGTGATGGGTCTATGTTGCTT
GATGACACAGCAACGATGCTTGGGGAGAAAATGGCCCTCTCAAATATAAATTCGCTGAGATCATATAAAGTTGTTGATCAAGTCAAGCAAGCGCTCGAGAAGGACTGCCCAGGAGTGGTT
TCCTGTGCTGACATCATAATCATGGCTTCCAGAGATGCTGTCGCTCTG
ACAGGTGGACCCGAGTGGGAGGTGAGGTTGGGAAGATTGGACAGCTTGAGTGCGAGTCAAGAAGACTCAAAC
AACATCATGCCGAGCCCAAGAGCCAACGCAAGCTCTCTTATTGATCTCTTCCAGAAATATAACCTCAGCGTGAAAGACCTTGTAGCACTCTCAGGATCTCACTCTATTGGCCAAGGTCGT
TGTTTCTCCATCATGTTTAGGCTATACAATCAATCTGGAACTGGAAGGCCTGATCCTGCCATTGATCCTAGCTATAGGCAAGAGCTTAACAGGATATGTCCACTGGATGTTGACCAAAAT
GTCACTGGGAACCTTGATTCCACGCCTCTCGTCTTTGATAACCAATATTTCAAGGATTTGGTTGCTGGGAGGGGCTTTCTCAACTCTGATCAAACACTCTTCACATCCCCTCACACAAGG
GAGTTTGTGAGGTTATTTAGTAGACGCCAAACTGAGTTTTTCAAAGCATTTGTCGAAGGAATGTTGAAGATGGGTGACTTGCAGTCTGGTCGTCCTGGGGAAGTTAGGACTAATTGCCGG
TTCGTCAACGCTCGCCCGGCTAATTTGCTGCTTCAGTCTCCACGCGACATGGAGAGTAACGATAAATAA

Retrieve as FASTA