Entry information : GmPrx50 (Glyma14g38210.1)
Entry ID 545
Creation 2007-02-02 (Christophe Dunand)
Last sequence changes 2011-07-04 (Qiang Li)
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2011-12-13 (Qiang Li)
Peroxidase information: GmPrx50 (Glyma14g38210.1)
Name (synonym) GmPrx50 (Glyma14g38210.1)
Class Class III peroxidase    [Orthogroup: Prx190]
Taxonomy Eukaryota Viridiplantae Streptophyta Fabaceae Glycine
Organism Glycine max (soybean)    [TaxId: 3847 ]
Cellular localisation N/D
Tissue types Etiolated hypocotyls
Floral meristems
Hypocotyls
Leaves
Mature flowers
Roots
Seedlings
Inducers Pathogen interaction
Phytophthora infection
Pseudomonas syringae infection
Wounding
Repressor N/D
Best BLASTp hits
Perox score E-value GmPrx50
start..stop
S start..stop
GmPrx121 590 0 23..324 23..324
PvPrx03 542 0 1..324 1..324
MtPrx29 482 2e-173 1..324 1..326
QsPrx02 434 2e-154 4..324 5..329
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 47408406..47408630 225 N° 2 47411143..47411325 183 N° 3 47411705..47411873 169 N° 4 47412827..47413224 398
join(47408406..47408630,47411143..47411325,47411705..47411873,47412827..47413224 )


exon

Literature and cross-references GmPrx50 (Glyma14g38210.1)
Literature Public Soybean EST Project. Tyler,B. Not Published. Vodkin,L Functional Genomics Program for Soybean.
DNA ref. Phytozome 12:   Gm14 (47408406..47413224)
Protein sequence: GmPrx50 (Glyma14g38210.1)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   325 (296)
PWM (Da):   %s   35162.97 (32261.5)  
PI (pH):   %s   9.68 (9.68) Peptide Signal:   %s   cut: 29 range:29-324
Sequence 366
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MTLSSSSSTSIFALALFTTLLLIGSSSAQLSENFYDSKCPKVFYAVKSVLQSALAKEPRQGASIVRLFFHDCFVNGCDGSVLLDGPSSEKIALPNKNSLRGYEVIDAIKSKVEALCPGVVSCADIVTIAARDSVAILGGPNWKVKLGRRDSTTGFFNLANSGVLPGPNSSLSSLIQRFDDQGLSTKDMVALSGAHTIGKARCVSYRDRIYNENNIDSLFAKARQKNCPKGSSGTPKDNNVAPLDFKTPNHFDNEYFKNLINKKGLLRSDQELFNGGSTDSLVRTYSNNQRVFEADFVTAMIKMGNIKPLTGSNGQIRKQCRRPN*

Retrieve as FASTA  
Remarks Complete sequence from genomic and 20+8 ESTs. TC192070, TC216324 and TC216323 (3'UTR is different).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
TGACACTTTCTTCTTCATCTTCAACATCCATATTTGCTTTAGCTTTGTTCACTACTCTTTTGCTTATAGGAAGTTCTTCAGCTCAACTCTCTGAGAACTTCTATGATAGTAAATGTCCCA
AGGTTTTCTATGCCGTAAAATCCGTTCTTCAATCTGCTTTGGCTAAAGAACCTCGCCAGGGAGCATCTATCGTTCGCCTCTTCTTTCATGACTGCTTTGTCAAT
GTAAATTACTCTTCAT
CTATGTTTAGTTTTTATTTTTCTTTAGTTATATATACTATAATACTATATGTTATTCTATGGTTTATCAAGGGTAATACTTTTATTTTGTCAGCTATCAAGGGTAATAATACCTAACTAC
TTTTAGCATCAATCAAACAAAACCTATAAATTCATATGATTGTCAACAAATTTTTTTTCAAAGATTTCAAATCGTTCATTTATTCATTCATTAGGAACGTAATGGGTTGTGTGTGGATAA
TCGTAATTGCTAAAATACAAGTATTTAATAATGCAATACTATGTTCTTTTTAGTTGCTACCGGTCATTTATACGTATTTTTCTTTCTTTCCAAGTTTAATCGCTTTCAACAAGTCTTATT
CGATGATGTGACATCACCAATAATGACACGTTTGAAGCATAAAAAAAATGAAGTGAAAATGTTGTTCTCATTATTGAAAAAATAACATTTTATGACTGTTTTTAAGGATTTTTAATAATT
AACGGTTTTTAATCGTAGTTGTAGTCATTATTGTGAAATTTTTTTAACTTTTCACCATAGTTCACAAACACTTTTTAAAAGTTACAATTTCTAAAATAGTTTTTTTAAGAATCTTTTTAA
TTAGAAATTATTTCNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNAAATTATCAGATGATGAAAAACCAAAATTATTATATGTTATAAAAAAGAAATATTAAGAGACAAAATACAAAGAAAAGGTCTGAATATGAAGATATATCCAAATGTTTTTATGGTT
AATTACGTACACCACTTTTTTTTAAAACACAGGGTTTTGGTTTTTCCGGCCATAGGTCCGAATCTCTAATAGAATAAATTAGTATATTTAAATATTTTTAGTCGAAGTTGAGTCATCATG
CAAGATAACATAATAGAGTTTTTAAGGTGGCGTGAATAATACTGNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNGCTAACCGTATCAAAATTTCTAAAATTATTGGAGTACATGAGTACAATCTCAATATAAATTCTATTTATTTA
TAACTAGAATAAAGTGTTTTACATGAGTACAATCTTTCATAAATAATTTATACATCTATTTTTCTTTTCAATTAATTTCCTTTGCACAGTAAATTAATTTATCACAATGCACATTAGATG
ATGCAAATTATGGTCACACTTGGGTTGAATGTTTATTTTTTGTTTTTATTTTTTGAAAATAACTTCTTTCTAAAATTTTCAAGATTTATAAAACAGCGAAAAAAAAGACTCTAACATATT
ACCATGTTTTCATTTCTTTAGAAAAAAATAAAAACGTTTATATGTTTTTTTCAATTTTAAATTTATTTTTAAAATTTTAAACAAACGTATTTTTACTCTTATTTTTTGTTTTCTTTAAAA
ATTAAAACAGAAAACACGTACTCCAATTAAAACATTCCATGTAGGTTGTAGAATAATATATTTCCATCAAGAAGTAAAAGATAATCGATAATAAAATACTATCCACAAAGAAGTAAGAAT
GTCAAAATAGATTCAATCAACTGTAAATTTATTTTATTTAATACTTTAAAATGAGTTGGGTTGAGTTATTTAATTCAATCATTTAACTTGCATAATTCGTCTAACTCAATTATTGGCCAA
CTCAATGAGTCCTGACTTTAGTTGACTTATCAGATTAAACTTTTTTTAGTTAATTATTTTGATGAGTTTAGTTAAATATTATTTTATTAAACATATAAATTCTATGTTATTTTATTGCTT
TGTTTTACATTCATTTAAAACACGATTATAGTTTTTAAATATCATTTGTGCTAAGATAATCTAGTAAGATAAAACTTTTTATAATTATGACATTATGTTTCCTCATATTTCATATATATT
TCCATAAAATAATTTTGGCAGCCAAGTTCGACCCGCAACCTATATTAATTGTGTAGGGTTGAAATTCTTAATCCAATCTCTAGTCCAACCCATCCCAGCAGGGATGAGTTATGTTAAGCC
TATTTTAATTAACATCCTACCTACATTCATGCCAACACTTAATATATTCAACTATGGTGTTCATTAAACATATGCATTTTTTTTTTGGCTTAGAAGTGCTTCCTTCTAAAGTAAACTTTC
ACCTACCAATCCAATTTCGATAAAGTTAGTCACTGTTCTATAAATTAATTACAACTAATTATTGCTAATTGTGTATTGCTGCTTAATTGGAAACAGGGTTGTGATGGATCAGTGTTACTT
GATGGCCCTTCCTCGGAGAAGATTGCACTTCCCAACAAGAACTCTTTGAGAGGTTATGAAGTCATTGATGCCATCAAGTCTAAGGTGGAGGCACTATGCCCTGGAGTGGTGTCATGTGCT
GATATCGTTACCATTGCTGCTCGTGACTCTGTTGCAATT
GTGAGTTCAAAACCAATATAGACTATAAGATCATATTTAATTAATTAAGATTTTATAAAAAAATATATATTTAACATTTTT
AAGTATTTATACAAATACCAAGTAGAAGTTTGGTTGTGCGTTCAAAACGTGAAAAACCAAGTCATTCGCAAGAAAGACGTGGAGGCTAGCTACACTGTGTAGCTGCTTGATGGATGTCAA
AAAATGTGAAACCAAACATGCTCTATAAGTAACTTTTAATTTTGACAACTTATGTATGGTTATATGCCTTTGATAGAGTATATCATTACTCCACACACATATATTATATATAGATGTATA
GGGTTGTTGAATACTTATTTATCAATTTGTATGGTTTATAAAATTTCATGATATGCAGCTTGGAGGGCCAAATTGGAAGGTTAAACTTGGTAGAAGGGATTCCACGACTGGCTTTTTCAA
CCTTGCAAACAGTGGTGTGCTTCCAGGACCGAATTCTTCCCTCAGCAGCCTTATCCAAAGATTTGATGATCAAGGGCTCTCTACCAAGGACATGGTTGCATTATCAG
GTACATTTACTTT
TCTCTTTTTTCTAGTTTGGTATATTTTCAAGATGACTTTATAGTTAATTTATACAAACGTATGGCTTTCCATCCAAAGAAATTTAATTTGTTTATTTATACAGTATTTCCATAAGACTGA
GATAAGAGAAGAAGTGAGAAAAATAAGAAATGAAATAATAGATGAGTATTGTGATAATAAAAGAAATTTTATTATATAATACAATATCTCACTATCTCTTTACTTAATAATTACTTGTAG
TGGATATATATGTGGACCTGGATGTGACATTTAAATTACCACGTAAATGCATGCCATGCTCTTTCTCTAGGCTAAAAGCCATTTGACTTCTAAACAGAGAAGAGTCAAGTTAAAGGAAAA
GCATGTTTAACTAACTTGAAAAAGATATATACGGTATTATTGATCGGTAATGCTTAATTGTTTCCACAGCCAAAAAAGAATAACACCATCCATTTACATGCCTCAAGAGTCTTTCATTAT
TTGTATATTATATTTATTTATGTTAACTGCATATTCAATTTATACACTGGATTAAGGAACGTACTTACTATTTGACAAGTAAATTGTATATGTGGTGAAATTCAAATGTAAAAGTATGAA
TTAATTATCAATTTCATTAGTGCATCAATTCTATATATAACACCATGAATATATACAAAAGAACTATTCAACTATATCTTCATGTTTCAAATTTTTTTTGTCATGTTAAAAACTTTATTT
ACATTGCAGCTGATTTTAATTATTGAAATCTTAGGCTAAANNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNCATGTCACAAGTGTTATTATTTAGACCACCCCTGTTTATTTGATATTTTCTTTGAGATTTCAGGAGCACACACAATTGGAAAG
GCAAGGTGTGTCAGTTATAGAGATCGCATATACAATGAAAACAACATTGACAGTTTATTTGCCAAGGCAAGGCAAAAGAACTGTCCAAAGGGTAGCAGTGGAACACCAAAGGACAACAAT
GTAGCACCACTAGACTTCAAAACTCCTAACCATTTCGATAACGAATACTTCAAGAACCTCATCAACAAAAAGGGTCTCCTTCGTTCTGATCAAGAGCTCTTCAATGGAGGATCCACAGAT
TCACTAGTGAGAACTTACAGCAACAATCAAAGGGTCTTTGAGGCTGACTTCGTCACTGCAATGATTAAGATGGGAAACATCAAACCCTTAACTGGGTCAAATGGGCAGATAAGGAAGCAA
TGTAGGAGGCCAAATTAG

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
TGACACTTTCTTCTTCATCTTCAACATCCATATTTGCTTTAGCTTTGTTCACTACTCTTTTGCTTATAGGAAGTTCTTCAGCTCAACTCTCTGAGAACTTCTATGATAGTAAATGTCCCA
AGGTTTTCTATGCCGTAAAATCCGTTCTTCAATCTGCTTTGGCTAAAGAACCTCGCCAGGGAGCATCTATCGTTCGCCTCTTCTTTCATGACTGCTTTGTCAAT
GGTTGTGATGGATCAG
TGTTACTTGATGGCCCTTCCTCGGAGAAGATTGCACTTCCCAACAAGAACTCTTTGAGAGGTTATGAAGTCATTGATGCCATCAAGTCTAAGGTGGAGGCACTATGCCCTGGAGTGGTGT
CATGTGCTGATATCGTTACCATTGCTGCTCGTGACTCTGTTGCAATT
CTTGGAGGGCCAAATTGGAAGGTTAAACTTGGTAGAAGGGATTCCACGACTGGCTTTTTCAACCTTGCAAACA
GTGGTGTGCTTCCAGGACCGAATTCTTCCCTCAGCAGCCTTATCCAAAGATTTGATGATCAAGGGCTCTCTACCAAGGACATGGTTGCATTATCAG
GAGCACACACAATTGGAAAGGCAA
GGTGTGTCAGTTATAGAGATCGCATATACAATGAAAACAACATTGACAGTTTATTTGCCAAGGCAAGGCAAAAGAACTGTCCAAAGGGTAGCAGTGGAACACCAAAGGACAACAATGTAG
CACCACTAGACTTCAAAACTCCTAACCATTTCGATAACGAATACTTCAAGAACCTCATCAACAAAAAGGGTCTCCTTCGTTCTGATCAAGAGCTCTTCAATGGAGGATCCACAGATTCAC
TAGTGAGAACTTACAGCAACAATCAAAGGGTCTTTGAGGCTGACTTCGTCACTGCAATGATTAAGATGGGAAACATCAAACCCTTAACTGGGTCAAATGGGCAGATAAGGAAGCAATGTA
GGAGGCCAAATTAG

Retrieve as FASTA