Entry information : GmPrx50 (Glyma14g38210.1)
Entry ID 545
Creation 2007-02-02 (Christophe Dunand)
Last sequence changes 2011-07-04 (Qiang Li)
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2011-12-13 (Qiang Li)
Peroxidase information: GmPrx50 (Glyma14g38210.1)
Name (synonym) GmPrx50 (Glyma14g38210.1)
Class Class III peroxidase    [Orthogroup: Prx226]
Taxonomy Eukaryota Viridiplantae Streptophyta Fabaceae Glycine
Organism Glycine max (soybean)    [TaxId: 3847 ]
Cellular localisation N/D
Tissue types Etiolated hypocotyls
Floral meristems
Hypocotyls
Leaves
Mature flowers
Roots
Seedlings
Inducers Pathogen interaction
Phytophthora infection
Pseudomonas syringae infection
Wounding
Repressor N/D
Best BLASTp hits
Perox score E-value GmPrx50
start..stop
S start..stop
GmPrx121 590 0 23..325 23..325
PvPrx03 542 0 1..324 1..324
MtPrx29 482 2.22e-173 1..324 1..326
QsPrx02 434 1.87e-154 4..324 5..329
Gene structure Fichierperl './assets/cgi-bin/draw_exon.pl' '545' 'join(47408406..47408630,47411143..47411325,47411705..47411873,47412827..47413224)' Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 47408406..47408630 223 N° 2 47411143..47411325 181 N° 3 47411705..47411873 167 N° 4 47412827..47413224 396
join(47408406..47408630,47411143..47411325,47411705..47411873,47412827..47413224 )


exon

Literature and cross-references GmPrx50 (Glyma14g38210.1)
Literature Public Soybean EST Project. Tyler,B. Not Published. Vodkin,L Functional Genomics Program for Soybean.
DNA ref. Phytozome 12:   Gm14 (47408406..47413224)
Protein sequence: GmPrx50 (Glyma14g38210.1)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   324 (296)
PWM (Da):   %s   35162.97 (32261.5)  
PI (pH):   %s   9.68 (9.68) Peptide Signal:   %s   cut: 29 range:29-324
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MTLSSSSSTSIFALALFTTLLLIGSSSAQLSENFYDSKCPKVFYAVKSVLQSALAKEPRQGASIVRLFFHDCFVNGCDGSVLLDGPSSEKIALPNKNSLRGYEVIDAIKSKVEALCPGVV
SCADIVTIAARDSVAILGGPNWKVKLGRRDSTTGFFNLANSGVLPGPNSSLSSLIQRFDDQGLSTKDMVALSGAHTIGKARCVSYRDRIYNENNIDSLFAKARQKNCPKGSSGTPKDNNV
APLDFKTPNHFDNEYFKNLINKKGLLRSDQELFNGGSTDSLVRTYSNNQRVFEADFVTAMIKMGNIKPLTGSNGQIRKQCRRPN*

Retrieve as FASTA  
Remarks Complete sequence from genomic and 20+8 ESTs. TC192070, TC216324 and TC216323 (3'UTR is different).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGACACTTTCTTCTTCATCTTCAACATCCATATTTGCTTTAGCTTTGTTCACTACTCTTTTGCTTATAGGAAGTTCTTCAGCTCAACTCTCTGAGAACTTCTATGATAGTAAATGTCCC
AAGGTTTTCTATGCCGTAAAATCCGTTCTTCAATCTGCTTTGGCTAAAGAACCTCGCCAGGGAGCATCTATCGTTCGCCTCTTCTTTCATGACTGCTTTGTCAAT
ATGTAAATTACTCTT
CATCTATGTTTAGTTTTTATTTTTCTTTAGTTATATATACTATAATACTATATGTTATTCTATGGTTTATCAAGGGTAATACTTTTATTTTGTCAGCTATCAAGGGTAATAATACCTAAC
TACTTTTAGCATCAATCAAACAAAACCTATAAATTCATATGATTGTCAACAAATTTTTTTTCAAAGATTTCAAATCGTTCATTTATTCATTCATTAGGAACGTAATGGGTTGTGTGTGGA
TAATCGTAATTGCTAAAATACAAGTATTTAATAATGCAATACTATGTTCTTTTTAGTTGCTACCGGTCATTTATACGTATTTTTCTTTCTTTCCAAGTTTAATCGCTTTCAACAAGTCTT
ATTCGATGATGTGACATCACCAATAATGACACGTTTGAAGCATAAAAAAAATGAAGTGAAAATGTTGTTCTCATTATTGAAAAAATAACATTTTATGACTGTTTTTAAGGATTTTTAATA
ATTAACGGTTTTTAATCGTAGTTGTAGTCATTATTGTGAAATTTTTTTAACTTTTCACCATAGTTCACAAACACTTTTTAAAAGTTACAATTTCTAAAATAGTTTTTTTAAGAATCTTTT
TAATTAGAAATTATTTCNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNAAATTATCAGATGATGAAAAACCAAAATTATTATATGTTATAAAAAAGAAATATTAAGAGACAAAATACAAAGAAAAGGTCTGAATATGAAGATATATCCAAATGTTTTTATG
GTTAATTACGTACACCACTTTTTTTTAAAACACAGGGTTTTGGTTTTTCCGGCCATAGGTCCGAATCTCTAATAGAATAAATTAGTATATTTAAATATTTTTAGTCGAAGTTGAGTCATC
ATGCAAGATAACATAATAGAGTTTTTAAGGTGGCGTGAATAATACTGNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNGCTAACCGTATCAAAATTTCTAAAATTATTGGAGTACATGAGTACAATCTCAATATAAATTCTATTTAT
TTATAACTAGAATAAAGTGTTTTACATGAGTACAATCTTTCATAAATAATTTATACATCTATTTTTCTTTTCAATTAATTTCCTTTGCACAGTAAATTAATTTATCACAATGCACATTAG
ATGATGCAAATTATGGTCACACTTGGGTTGAATGTTTATTTTTTGTTTTTATTTTTTGAAAATAACTTCTTTCTAAAATTTTCAAGATTTATAAAACAGCGAAAAAAAAGACTCTAACAT
ATTACCATGTTTTCATTTCTTTAGAAAAAAATAAAAACGTTTATATGTTTTTTTCAATTTTAAATTTATTTTTAAAATTTTAAACAAACGTATTTTTACTCTTATTTTTTGTTTTCTTTA
AAAATTAAAACAGAAAACACGTACTCCAATTAAAACATTCCATGTAGGTTGTAGAATAATATATTTCCATCAAGAAGTAAAAGATAATCGATAATAAAATACTATCCACAAAGAAGTAAG
AATGTCAAAATAGATTCAATCAACTGTAAATTTATTTTATTTAATACTTTAAAATGAGTTGGGTTGAGTTATTTAATTCAATCATTTAACTTGCATAATTCGTCTAACTCAATTATTGGC
CAACTCAATGAGTCCTGACTTTAGTTGACTTATCAGATTAAACTTTTTTTAGTTAATTATTTTGATGAGTTTAGTTAAATATTATTTTATTAAACATATAAATTCTATGTTATTTTATTG
CTTTGTTTTACATTCATTTAAAACACGATTATAGTTTTTAAATATCATTTGTGCTAAGATAATCTAGTAAGATAAAACTTTTTATAATTATGACATTATGTTTCCTCATATTTCATATAT
ATTTCCATAAAATAATTTTGGCAGCCAAGTTCGACCCGCAACCTATATTAATTGTGTAGGGTTGAAATTCTTAATCCAATCTCTAGTCCAACCCATCCCAGCAGGGATGAGTTATGTTAA
GCCTATTTTAATTAACATCCTACCTACATTCATGCCAACACTTAATATATTCAACTATGGTGTTCATTAAACATATGCATTTTTTTTTTGGCTTAGAAGTGCTTCCTTCTAAAGTAAACT
TTCACCTACCAATCCAATTTCGATAAAGTTAGTCACTGTTCTATAAATTAATTACAACTAATTATTGCTAATTGTGTATTGCTGCTTAATTGGAAACAGGGTTGTGATGGATCAGTGTTA
CTTGATGGCCCTTCCTCGGAGAAGATTGCACTTCCCAACAAGAACTCTTTGAGAGGTTATGAAGTCATTGATGCCATCAAGTCTAAGGTGGAGGCACTATGCCCTGGAGTGGTGTCATGT
GCTGATATCGTTACCATTGCTGCTCGTGACTCTGTTGCAATT
TTGTGAGTTCAAAACCAATATAGACTATAAGATCATATTTAATTAATTAAGATTTTATAAAAAAATATATATTTAACA
TTTTTAAGTATTTATACAAATACCAAGTAGAAGTTTGGTTGTGCGTTCAAAACGTGAAAAACCAAGTCATTCGCAAGAAAGACGTGGAGGCTAGCTACACTGTGTAGCTGCTTGATGGAT
GTCAAAAAATGTGAAACCAAACATGCTCTATAAGTAACTTTTAATTTTGACAACTTATGTATGGTTATATGCCTTTGATAGAGTATATCATTACTCCACACACATATATTATATATAGAT
GTATAGGGTTGTTGAATACTTATTTATCAATTTGTATGGTTTATAAAATTTCATGATATGCAGCTTGGAGGGCCAAATTGGAAGGTTAAACTTGGTAGAAGGGATTCCACGACTGGCTTT
TTCAACCTTGCAAACAGTGGTGTGCTTCCAGGACCGAATTCTTCCCTCAGCAGCCTTATCCAAAGATTTGATGATCAAGGGCTCTCTACCAAGGACATGGTTGCATTATCAG
AGGTACAT
TTACTTTTCTCTTTTTTCTAGTTTGGTATATTTTCAAGATGACTTTATAGTTAATTTATACAAACGTATGGCTTTCCATCCAAAGAAATTTAATTTGTTTATTTATACAGTATTTCCATA
AGACTGAGATAAGAGAAGAAGTGAGAAAAATAAGAAATGAAATAATAGATGAGTATTGTGATAATAAAAGAAATTTTATTATATAATACAATATCTCACTATCTCTTTACTTAATAATTA
CTTGTAGTGGATATATATGTGGACCTGGATGTGACATTTAAATTACCACGTAAATGCATGCCATGCTCTTTCTCTAGGCTAAAAGCCATTTGACTTCTAAACAGAGAAGAGTCAAGTTAA
AGGAAAAGCATGTTTAACTAACTTGAAAAAGATATATACGGTATTATTGATCGGTAATGCTTAATTGTTTCCACAGCCAAAAAAGAATAACACCATCCATTTACATGCCTCAAGAGTCTT
TCATTATTTGTATATTATATTTATTTATGTTAACTGCATATTCAATTTATACACTGGATTAAGGAACGTACTTACTATTTGACAAGTAAATTGTATATGTGGTGAAATTCAAATGTAAAA
GTATGAATTAATTATCAATTTCATTAGTGCATCAATTCTATATATAACACCATGAATATATACAAAAGAACTATTCAACTATATCTTCATGTTTCAAATTTTTTTTGTCATGTTAAAAAC
TTTATTTACATTGCAGCTGATTTTAATTATTGAAATCTTAGGCTAAANNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNCATGTCACAAGTGTTATTATTTAGACCACCCCTGTTTATTTGATATTTTCTTTGAGATTTCAGGAGCACACACAAT
TGGAAAGGCAAGGTGTGTCAGTTATAGAGATCGCATATACAATGAAAACAACATTGACAGTTTATTTGCCAAGGCAAGGCAAAAGAACTGTCCAAAGGGTAGCAGTGGAACACCAAAGGA
CAACAATGTAGCACCACTAGACTTCAAAACTCCTAACCATTTCGATAACGAATACTTCAAGAACCTCATCAACAAAAAGGGTCTCCTTCGTTCTGATCAAGAGCTCTTCAATGGAGGATC
CACAGATTCACTAGTGAGAACTTACAGCAACAATCAAAGGGTCTTTGAGGCTGACTTCGTCACTGCAATGATTAAGATGGGAAACATCAAACCCTTAACTGGGTCAAATGGGCAGATAAG
GAAGCAATGTAGGAGGCCAAATTAG

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGACACTTTCTTCTTCATCTTCAACATCCATATTTGCTTTAGCTTTGTTCACTACTCTTTTGCTTATAGGAAGTTCTTCAGCTCAACTCTCTGAGAACTTCTATGATAGTAAATGTCCC
AAGGTTTTCTATGCCGTAAAATCCGTTCTTCAATCTGCTTTGGCTAAAGAACCTCGCCAGGGAGCATCTATCGTTCGCCTCTTCTTTCATGACTGCTTTGTCAAT
GGTTGTGATGGATCA
GTGTTACTTGATGGCCCTTCCTCGGAGAAGATTGCACTTCCCAACAAGAACTCTTTGAGAGGTTATGAAGTCATTGATGCCATCAAGTCTAAGGTGGAGGCACTATGCCCTGGAGTGGTG
TCATGTGCTGATATCGTTACCATTGCTGCTCGTGACTCTGTTGCAATT
CTTGGAGGGCCAAATTGGAAGGTTAAACTTGGTAGAAGGGATTCCACGACTGGCTTTTTCAACCTTGCAAAC
AGTGGTGTGCTTCCAGGACCGAATTCTTCCCTCAGCAGCCTTATCCAAAGATTTGATGATCAAGGGCTCTCTACCAAGGACATGGTTGCATTATCAG
GAGCACACACAATTGGAAAGGCA
AGGTGTGTCAGTTATAGAGATCGCATATACAATGAAAACAACATTGACAGTTTATTTGCCAAGGCAAGGCAAAAGAACTGTCCAAAGGGTAGCAGTGGAACACCAAAGGACAACAATGTA
GCACCACTAGACTTCAAAACTCCTAACCATTTCGATAACGAATACTTCAAGAACCTCATCAACAAAAAGGGTCTCCTTCGTTCTGATCAAGAGCTCTTCAATGGAGGATCCACAGATTCA
CTAGTGAGAACTTACAGCAACAATCAAAGGGTCTTTGAGGCTGACTTCGTCACTGCAATGATTAAGATGGGAAACATCAAACCCTTAACTGGGTCAAATGGGCAGATAAGGAAGCAATGT
AGGAGGCCAAATTAG

Retrieve as FASTA