Entry information : OsRboh06(LOC_Os08g35210 / OsNox06 / RbohE)
Entry ID 5569
Creation 2007-07-23 (Christophe Dunand)
Last sequence changes 2010-08-06 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2022-02-28 (Christophe Dunand)
Peroxidase information: OsRboh06(LOC_Os08g35210 / OsNox06 / RbohE)
Name OsRboh06(LOC_Os08g35210 / OsNox06 / RbohE)
Class Respiratory burst oxidase homolog    [Orthogroup: Rboh001]
Taxonomy Viridiplantae (green plants); Streptophyta; Angiospermae; Monocotyledons
Organism Oryza sativa ssp japonica cv Nipponbare    [TaxId: 39947 ]
Cellular localisation N/D
Tissue types Inflorescences
Whole plant
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value OsRboh06
S start..stop
ZmRboh08 1488 0 1..978 1..1000
SbRboh02 1483 0 1..978 1..1007
OsRboh07 1470 0 1..978 1..1007
SbRboh06 1409 0 1..978 1..959
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 1..685 685 N° 2 779..938 160 N° 3 1037..1085 49 N° 4 1324..1437 114
N° 5 1525..2016 492 N° 6 3150..3539 390 N° 7 6488..6583 96 N° 8 7206..7321 116
N° 9 7433..7603 171 N° 10 7687..7846 160 N° 11 7949..8134 186 N° 12 8226..8354 129
N° 13 8479..8557 79 N° 14 8720..8829 110  
join(1..685,779..938,1037..1085,1324..1437,1525..2016,3150..3539,6488..6583,7206 ..7321,7433..7603,7687..7846,7949..8134,8226..8354,8479..8557,8720..8829)


Literature and cross-references OsRboh06(LOC_Os08g35210 / OsNox06 / RbohE)
Literature Sasaki T., Matsumoto T., Yamamoto K. Oryza sativa nipponbare(GA3)genomic DNA, chromosome 8, PAC clone:P0048G02. Submitted (JAN-2002) to the EMBL/GenBank/DDBJ databases.
Protein ref. UniProtKB:   B8BBA2 [Incorrect splicing]   Q0J595 [Incorrect splicing]   Q6ZAG4 [Incorrect splicing]
DNA ref. GenBank:   NC_008401.2 (22203440..22212265)
Cluster/Prediction ref. UniGene:   Os.5679
Protein sequence: OsRboh06(LOC_Os08g35210 / OsNox06 / RbohE)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   978
PWM (Da):   %s   109607.12 Transmb domain:   %s   o418-437i551-573o600-622i780-797o
PI (pH):   %s   9.95
Send to BLAST
Send to Peroxiscan

Retrieve as FASTA  
Remarks Complete sequence from genomic (chromo 8, 13 introns), 2 mRNA and 12 ESTs. Incorrect prediction from Phytozome (splicing errors: missing exons and extra exon).
Three SwissProt/TREMBL accessions: none are completly correct: Q0J595 (uncorrect splicing prediction), A3BTR7 (differential splicing prediction, shorter sequence), Q6ZAG4 (differential splicing prediction, shorter sequence). ESTs for the 3'end do not allow to confirm one prediction. The two following parts have been removed form the predicted sequence (Q0J595): (KQAKPSSMSMARRARARSRDDTAYGAGIGAG)(KVESSSGFKWAPPGRSNQCSVAGEPAGTEDPRPGRLRVKAPVIQKSPRPTGLPLSCGA) and (QISDQSFDARLQIFFDMVDTNVDGRITREEVQEL)has been added.
Send to BLAST

Retrieve as FASTA  
Send to BLAST

Retrieve as FASTA