Entry information : AniGPx
Entry ID 5580
Creation 2007-07-24 (Christophe Dunand)
Last sequence changes 2011-11-10 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2012-04-23 (Catherine Mathe (Scipio))
Peroxidase information: AniGPx
Name AniGPx
Class Fungi-Bacteria glutathione peroxidase    [Orthogroup: Gpx3001]
Taxonomy Eukaryota Fungi Ascomycota Eurotiomycetes Trichocomaceae Emericella
Organism Aspergillus nidulans-Emericella nidulans    [TaxId: 162425 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value AniGPx
start..stop
S start..stop
AteGPx 325 3.32e-114 89..273 1..185
MrubGPx01 317 1.17e-110 89..282 1..193
AcarGPx01 317 1.18e-109 84..282 69..267
NfGPx 316 1.43e-109 37..282 4..240
Gene structure Fichier Exons


exon

Literature and cross-references AniGPx
Literature Galagan JE et al., Sequencing of Aspergillus nidulans and comparative analysis with A. fumigatus and A. oryzae. Nature 438:1105-1115(2005).
Protein ref. UniProtKB:   Q5B9D4
DNA ref. JGI genome:   ChrVI_A_nidulans_FGSC_A4 (2617777..2616851)
EST ref. GenBank:   AA783765 [5' end]  AA786420 [3' end]
Protein sequence: AniGPx
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   282
PWM (Da):   %s   31095.08  
PI (pH):   %s   10.08
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MPFTYCGLVPRLLSFRSSSSSTRQVRLRIPIQKTTASPGRISGATISSSFASRTSACILHFPSHRTLLQRQQPHLRPSQSTARYRFSTMASATTFYDFEPVDKKGEAYPLNQLKGKVILV
VNTASKCGFTPQFKGLETLYQSIKAKRPDDFVILGFPCNQFGGQDPGSNDQIQEFCQLNYGVTFPVLGKTEVNGDNANPLWTWLKESQPGLLGLKRIKWNFEKFLISADGKVVGRWASTT
KPEGLESRILEEIEKAEKQGLLASKAMQPEAAGTDGETAKL

Retrieve as FASTA  
Remarks Complete sequence from genomic (chromo 6, 1 intron) and 4 ESTs. Strain="FGSC A4".
DNA
Send to BLAST
CDS
Send to BLAST