Entry information : AfumGPx ( Hyr1)
Entry ID 5582
Creation 2007-07-24 (Christophe Dunand)
Last sequence changes 2011-11-14 (Christophe Dunand)
Sequence status complete
Reviewer Achraf Jemmat
Last annotation changes 2016-03-08 (Achraf Jemmat)
Peroxidase information: AfumGPx ( Hyr1)
Name (synonym) AfumGPx ( Hyr1)
Class Fungi-Bacteria glutathione peroxidase    [Orthogroup: Gpx3001]
Taxonomy Eukaryota Fungi Ascomycota Eurotiomycetes Trichocomaceae Neosartorya
Organism Aspergillus fumigatus    [TaxId: 746128 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value AfumGPx
start..stop
S start..stop
NfGPx 432 2.25e-156 8..232 3..233
AclGPx 357 1.76e-127 45..229 1..184
AcarGPx01 336 4.92e-118 24..235 54..267
AflGPx01 331 2.99e-116 36..235 57..256
Gene structure Fichier Exons


exon

Literature and cross-references AfumGPx ( Hyr1)
Literature Nierman W.C., et al., Genomic sequence of the pathogenic and allergenic filamentous fungus Aspergillus fumigatus. Nature 438:1151-1156(2005).
Protein ref. GenPept:   EAL92356 UniProtKB:   Q4WY97
DNA ref. GenBank:   AAHF01000002 (841947..841161)
Protein sequence: AfumGPx ( Hyr1)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   235 (320)
PWM (Da):   %s   25652.3 (34985.5)  
PI (pH):   %s   9.79 (4.96) Peptide Signal:   %s   cut: 32 range:32-351
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MVLLPSSLSPPSIIFRCSPLPYISRQSPINRLSSTRAPSLLIRTM
ASATTFYDFKPAD
KKGEPFDLASLKGKVVLVVNTASKCGFTPQFKGLENLYQSIKAKHPEDFTILGFPCNQFGSQDPGSNDEIQSFCQVNYGVTFPVLGKLDVNGDNAAPVWTWMKEMMPGLMGLKRVKWNFE
KFLISADGKVVGRWASITKPESLEATILKEIEKAKKEGTAASTRKGEGEATAQAKLS

Retrieve as FASTA  
Remarks Complete sequence from genomic (chromo 3, 1 intron). No EST available. Strain="Af293".
DNA
Send to BLAST
CDS
Send to BLAST