Entry information : GmPrx60 (Glyma02g15290.1)
Entry ID 559
Creation 2005-06-21 (Christophe Dunand)
Last sequence changes 2011-10-10 (Qiang Li)
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2011-12-13 (Qiang Li)
Peroxidase information: GmPrx60 (Glyma02g15290.1)
Name (synonym) GmPrx60 (Glyma02g15290.1)
Class Class III peroxidase    [Orthogroup: Prx024]
Taxonomy Eukaryota Viridiplantae Streptophyta Fabaceae Glycine
Organism Glycine max (soybean)    [TaxId: 3847 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value GmPrx60
start..stop
S start..stop
GmPrx163 503 0 22..332 20..338
GmPrx17 499 7.04e-180 22..332 20..338
PpePrx08 437 3.88e-155 9..331 8..332
CroPrx12 435 1.4e-154 1..331 1..330
Gene structure Fichierperl './assets/cgi-bin/draw_exon.pl' '559' 'complement(join(13790328..13790740,13791295..13791460,13791547..13791738,13792705..13792932))' Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 13792705..13792932 226 N° 2 13791547..13791738 190 N° 3 13791295..13791460 164 N° 4 13790328..13790740 411
complement(join(13790328..13790740,13791295..13791460,13791547..13791738,1379270 5..13792932))


exon

Literature and cross-references GmPrx60 (Glyma02g15290.1)
Literature Vodkin,L.et al, A Functional Genomics Program for Soybean.
DNA ref. Phytozome 12:   Gm02 (13792932..13790328)
Protein sequence: GmPrx60 (Glyma02g15290.1)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   332 (305)
PWM (Da):   %s   36917.35 (33567.7) Transmb domain:   %s   i5-27o
PI (pH):   %s   7.61 (7.24) Peptide Signal:   %s   cut: 28 range:28-332
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MICRLFTIYFTFFLCLLFTFFVPYVHSNNQLDTNFYDGSCPNLAT
IVRYGVWSAIKNDNRMAASLLRLHFHDCIVN
GCDASVLLDDTPYFTGEKNASPNRNSLRGMEVIDNIKEQVERQCPSTVSCADILSLAVREAIDLVGGPSWPVALGRRDATKANRMEANQQIPSPFEPLDNIIAKFTSKGLNLRDVVALSG
AHTIGYARCLTFKRRLFDFQGSGRPDPVLASSLLSKLQSTCPNGDTSNSYIAPLDSNTTLTFDNEYYRNLLYNKGLLESDMALLSDRRTSSMAYFYSTDQYSFYNDFAASMVKLSNVGVL
TGIQGQIRRKCGSVNY

Retrieve as FASTA  
Remarks Complete sequence from genomic and 1 EST.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGATTTGTAGACTTTTCACCATCTACTTCACTTTCTTCTTATGTTTGCTTTTTACCTTCTTCGTTCCTTATGTTCATAGCAATAACCAGCTTGATACCAATTTCTATGATGGATCATGC
CCCAATTTGGCCACGATTGTTAGATATGGTGTTTGGTCAGCCATTAAAAATGACAACAGAATGGCTGCGTCCCTCCTTCGGTTGCACTTTCACGATTGCATAGTAAAT
GTAAATTCTGTT
GTGCTTTAATTAGGATTTTGTTATTTCTTACACTTCAAAATGAACGTACTCTTTAGCATGGCTTTATATGTGCTTTCTGCCAGAGTCGAAATCATACCGCATCACACTAATTAGTAATAG
TATGTGTTTCTCACTTGCTTTACTAGAAGTTTTAATTTTGATGGTAGAAGCATGCGGTTAAATGAATCGGCAATAGAAATTAATTTTAGTTGAATATAATAGGTCCAGTTCAGCCTAATG
GTGAGTGAGACAAAAAAAATAATTGTTGTTTGTCCTTTTACGGCTTGAAGCTAATTCAAGAGTGTGACTATGCTATACGGCATAAAACTTGAAATCTATTTGTTCTTTCATTCATATCAC
ATACACAAATTAACTTCTTTCCCTGTTTCCCTTATATTTAATTGGGTAAAATATATTTTTATCATGTATTTTTAGTAAAATTTGATTTTAGTTCATGCATTTCAAATCCATCATTTTAGT
ACTCTTCAAACTTTGAAAAACATGTAAATTTATTTCATTAAATCGGCCATTTGTATTAAGGGGTACTAAATCTACATATTTTTTGAAGTTTAAAGATTAAAATAGTTGATTTTAAAATAC
AAAGACTAAAATCAATTTTTACAGGAAATACAGAGACTAAAAATATATTTCATCTTATTTAATTTTATTTTTATATTTGATTTAGAGGGAAAAAAGATGGGAGATATAAAAAAATTTAAA
AATGAATTAAAGAAAAAAGATGGGAGTATATTTTATTTCTAAATGTCAATTTTCTTTTATTTTTCTTCAATTAAAAAAACAAATGGTTAATTACGTGTTTTAAATCATGTAATAATTTCA
TCATTTTTACAGTATTTACATTGCATATGTAATTATTGTGCTTGGTGCCATGCCATTATAATCATGATAACTTACACGGGGACGTCATTAATTATGTTTAATTGCTTGTGAAAGGGGGTT
GTGATGCTTCTGTGCTTCTTGATGATACCCCATATTTCACGGGCGAAAAGAATGCTTCTCCTAATCGCAATTCACTTCGGGGGATGGAAGTGATTGATAATATAAAAGAACAAGTTGAAA
GGCAATGTCCATCAACAGTTTCTTGCGCTGATATCTTATCCTTAGCAGTTAGGGAAGCTATTGATCTG
GTAAAAGTGTCATTTACTTTATATTAATTGTTGATAGAAATTCTCAGATGAA
AGTTCCTTATAATTAAAACAACCTTTTTGCCTAGGTGTTGGAGGACCTTCTTGGCCTGTTGCATTAGGCCGAAGAGATGCAACAAAAGCCAATCGGATGGAAGCTAATCAACAAATTCCT
TCACCGTTCGAGCCTCTAGATAACATCATTGCAAAGTTTACTTCAAAGGGTCTTAACTTGAGAGATGTTGTAGCCCTTTCAG
GTTCTTACTCTTTTCACCAAATATTTGAAGCTTTTTTA
ATACATGACATCATACATAGTTAAATTCAATTTGATACAATAATGTATGAAATCTATATTTGATTCATTAAATAAAAATTTTAAAGGAGATTCTGGTCTATCTCATAAAGGATAGCAAAC
TACATTAAGATGATCTCCTGAGATTGTGTAATTACATATAATTCTATTCCTTTTTATTTTCCTACACTAACTCCTTTTAAGTTTGAAAATATTACACTAACACCAACTTACTAACACCCC
TTATATGTTTGAAAATATTACACTAGCATCACCTCAAACCTTATACTAATACCCCTACAAGAGAGCTGAAAGTAATGGTTAAAAAAATAGGAAACGAAACATCAGGAGTTGTTGCTATAA
TTTGTTCTAGAAAGTATAACTATTTAGTGGAGAGTCAGAATATAATTTGCTTTATATAGTTTGGGGATTATTTCCATACACAACCTATTATGGTGATGACTGATGAGTGTTTGATAATTG
ATATCAGTGACTTGATGTGTCTATTTCCATGATCAGGGGGGCACATACAATTGGTTATGCCCGATGCTTGACCTTCAAAAGGAGACTTTTTGATTTTCAAGGCTCTGGCAGACCTGATCC
TGTGCTTGCCTCTTCACTTCTCTCAAAATTGCAAAGCACGTGTCCAAATGGAGACACTTCAAACAGCTACATTGCACCTCTTGATTCTAATACTACTTTGACCTTCGACAATGAGTATTA
TAGAAATCTCTTATACAACAAAGGGCTTCTAGAATCTGACATGGCACTACTTTCGGATCGAAGGACTTCTTCTATGGCTTATTTTTACAGCACCGACCAATATTCCTTCTATAATGATTT
TGCTGCATCCATGGTGAAGCTTAGTAATGTTGGAGTACTTACAGGAATACAAGGGCAAATTAGAAGGAAATGTGGCTCTGTAAACTATTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGATTTGTAGACTTTTCACCATCTACTTCACTTTCTTCTTATGTTTGCTTTTTACCTTCTTCGTTCCTTATGTTCATAGCAATAACCAGCTTGATACCAATTTCTATGATGGATCATGC
CCCAATTTGGCCACGATTGTTAGATATGGTGTTTGGTCAGCCATTAAAAATGACAACAGAATGGCTGCGTCCCTCCTTCGGTTGCACTTTCACGATTGCATAGTAAAT
GGTTGTGATGCT
TCTGTGCTTCTTGATGATACCCCATATTTCACGGGCGAAAAGAATGCTTCTCCTAATCGCAATTCACTTCGGGGGATGGAAGTGATTGATAATATAAAAGAACAAGTTGAAAGGCAATGT
CCATCAACAGTTTCTTGCGCTGATATCTTATCCTTAGCAGTTAGGGAAGCTATTGATCTG
GTTGGAGGACCTTCTTGGCCTGTTGCATTAGGCCGAAGAGATGCAACAAAAGCCAATCGG
ATGGAAGCTAATCAACAAATTCCTTCACCGTTCGAGCCTCTAGATAACATCATTGCAAAGTTTACTTCAAAGGGTCTTAACTTGAGAGATGTTGTAGCCCTTTCAG
GGGCACATACAATT
GGTTATGCCCGATGCTTGACCTTCAAAAGGAGACTTTTTGATTTTCAAGGCTCTGGCAGACCTGATCCTGTGCTTGCCTCTTCACTTCTCTCAAAATTGCAAAGCACGTGTCCAAATGGA
GACACTTCAAACAGCTACATTGCACCTCTTGATTCTAATACTACTTTGACCTTCGACAATGAGTATTATAGAAATCTCTTATACAACAAAGGGCTTCTAGAATCTGACATGGCACTACTT
TCGGATCGAAGGACTTCTTCTATGGCTTATTTTTACAGCACCGACCAATATTCCTTCTATAATGATTTTGCTGCATCCATGGTGAAGCTTAGTAATGTTGGAGTACTTACAGGAATACAA
GGGCAAATTAGAAGGAAATGTGGCTCTGTAAACTATTAA

Retrieve as FASTA