Entry information : GmPrx62 (Glyma14g38170.1)
Entry ID 561
Creation 2005-06-21 (Christophe Dunand)
Last sequence changes 2011-07-04 (Qiang Li)
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2011-12-13 (Qiang Li)
Peroxidase information: GmPrx62 (Glyma14g38170.1)
Name (synonym) GmPrx62 (Glyma14g38170.1)
Class Class III peroxidase    [Orthogroup: Prx040]
Taxonomy Eukaryota Viridiplantae Streptophyta Fabaceae Glycine
Organism Glycine max (soybean)    [TaxId: 3847 ]
Cellular localisation N/D
Tissue types Etiolated seedlings
Hypocotyls
Plumules
Roots of 'Supernod' plants
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value GmPrx62
start..stop
S start..stop
GmPrx120 612 0 33..359 1..323
PvPrx10 556 0 38..359 8..327
MtPrx01 529 0 33..358 1..324
GmPrx70 522 0 52..359 18..325
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 47394926..47395243 318 N° 2 47393154..47393348 195 N° 3 47391702..47392268 567  
complement(join(47391702..47392268,47393154..47393348,47394926..47395243))


exon

Literature and cross-references GmPrx62 (Glyma14g38170.1)
Literature Public Soybean EST Project. Vodkin,L.et al, A Functional Genomics Program for Soybean.
DNA ref. Phytozome 12:   Gm14 (47395243..47391702)
Protein sequence: GmPrx62 (Glyma14g38170.1)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   360
PWM (Da):   %s   39988.64 Transmb domain:   %s   o5-27i40-62o
PI (pH):   %s   9.98
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MRLDGLWVPCTFTLYKSFLLLAMFCNTQTYNKMASFHIQYSFLVLVLAMVITLMNPTNATLSPHFYDKVCPQALPVIKSVVQRAIIRERRIGASLLRLHFHDCFVNGCDGSILLDDTRNFTGEKTALPNLNSVRGFSVVDEIKAAVDKACKRHVVSCADILAIAARDSIAIYGGPHYWYQVLLGRRDARTASKAAANSNLPPPTFSFSQLVSNFKSHGLNVRDLVALSGGHTIGFARCTTFRNRIYNVSNNIIDPTFAASVRKTCPKSGGDNNLHPLDATPTRVDTTYYTDLLHKKGLLHSDQELFKGKGTESDKLVQLYSRIPLAFARDFKASMIKMGNMKPLTGRQGEIRCNCRRVN*

Retrieve as FASTA  
Remarks Coplete sequence from genomic and 4 ESTs.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGAGGCTGGATGGCTTGTGGGTACCTTGTACCTTCACTTTATATAAGTCCTTTCTTTTGTTAGCAATGTTTTGTAACACCCAAACATATAACAAGATGGCTTCTTTTCATATCCAATAT
TCATTCCTTGTGCTTGTGCTTGCTATGGTGATCACATTGATGAACCCTACCAATGCAACCCTCTCTCCCCATTTCTATGATAAAGTTTGCCCTCAGGCATTGCCAGTTATAAAGTCAGTG
GTTCAACGAGCAATTATCCGTGAGCGACGCATCGGAGCATCTCTTCTGCGCTTGCATTTCCATGATTGTTTCGTAAAT
GTAAGTTACTACTATTAAACACTCTCAATTAATGTGCTATAT
GGAACAAGAAAAATATCTTAGCTTTTAACCAGTTAACATGTGCTAGCTAGTTTCATAAAGGGTTTTTTTTTTATAAAAAAAATGTAAATTTAGTCTCTTTTATGTTTTTAATGTTAACGC
AGGAACATAACTCATATTTTTTAAAAAAAAAAAAATTAAGGACAACATTTATTAATGTAAAAATATAAGAAACTTGATCACATTTAACTAAAAGTACAGGGATTAAAAACATTTTTGTCC
TTTTATAAATTATTATTGTGCCTCACTATAACTATTTTTTAATGATATATATAGATGCAATATTCATTCGATTGTATAGAATATGAAATTTCTCACTCTAAGAGCATCTAAATTTTTCCA
TTAAGCTGTTGTATATGAATGCCTATGTTACTGTTAACAAAAATGCTTAAGTGTGCATATATGGCATGTTTAAATTTGTGTAGTATCACCATTTAGACACAACAAAGAATCATTACAGTT
TTGTTTCCAATATAAACCTCTCGGAATATGAAAATGAAAAATCAAATTAGCTATTAGTTTTTGGTCCATTCGTGTAAAACCATGGCTGGAAAAAAAGTAAATGAAGCTCAGAGGTAAACT
TTAAAGTTTAATGACNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNCTATTAACACATATTTTTTCGTAATTTTAATTTGTGTCCCGAAACCCTCTTATTTAGAGCTAATTTATAAATGTTTTTTTTTCTATTGTAATTTTTTAGCACTCTAATT
TTAACACTAATTTTAATTTCTCTTTTTTTTATCATCATATCACTACTTTATGATCTTTATAGTTTATCTTTTCCCTTTTAAAATATATACATCACTCAAAGGGTCTGAAATAAATTCTTT
TAAAATTTTCTTAACTTGATTACATGCATAGTTGATAGGAACTTCATAACAAGTTTACGTACCAATCTATTTTTATATTTTACTTTTCTTTTTGCAATTATTGCTCCTATAACCACTTTT
TATCCTATCTTATCATCCACGTACAGTAACAGTGGGCCAGCAAGCAATAATCAATTGAACTTATTATTATATATGCTAGACAAACTGACAAAAATCATGCTACTATGATATGAAATAATG
AAACTATATACAAATTTTAAATTGTTTGGAAAACGATGCACACCTAACTCATGGCTGCTAGCTTTCATTAATTTTTCAAATAAAAACAGTAGCTTATTGTAATTACAATTTCAAGTCAAA
TTTCAATCTTCTTTGATGTTCAATGCTTTATCTTGTTTTTGTGAGCTGTAAAAGGTTTATAACAGGGTAAAATTGGTCACATAAAAAAATTGTCCAAAGAAAACCAAGACAATATTAATT
AATTCACCATGTCACTTCTACTATATATAGTAATGGTACCATAATTTAATTTAATTACGTACTGAAATATAATATGAATGCATTCGAAATTACAGGGGTGTGATGGATCAATATTGCTAG
ATGACACCCGAAACTTCACTGGCGAGAAGACTGCATTGCCAAATCTTAATTCAGTCAGAGGTTTTTCTGTGGTTGATGAAATCAAAGCTGCGGTGGACAAAGCCTGCAAACGCCATGTGG
TCTCATGTGCAGATATCTTGGCCATTGCAGCCCGTGATTCTATAGCCATA
GTAAGTACTTACTAACAAACTTTTCATTCTCATATCTAACACTATTAGAAAATGCCATTACTAACAGAAA
AGATTAATTAATAAGCTTGCTCTCATGAGTCATATATATGGTTATAATATTTTATCGATCTGACAGAAACTATTAGTTCGATCTGCCATTGCGAGAGCCCTCAGAAAATATTATAGTGAA
GACCAAACTTTAACACCTAAAGAGATAGAAAGAGAAGATAAATAAATGCAAGTAGTATAGATAACATGATGTAATAGAAAAATATTTATTAAAAACAAAAAAGAGAAAAGAAATCAAATG
TAATTTTATCAACGGATTAATACTCTTGCTTTTGCATTTATTTTGTGTTGAATCGTTAGATTTACCTCGGAATGTGTGCCAAAGCAAAAGAAAAAAACAAACACACCCTAAGTATACCCA
CGCATCACTATATTTTATTAAACAATAATTATTAAGGTATCCTATCAATACTCAGATGGTAAAATGGGTCAAGAATCAAGATATATAGAAGGGCTGAGCCAAATCTACTTGATAAAATTT
TGAGTTTGAGTTAGTCTGAATGGGATCTAATTTGCAAAAACTAGCAAAAGAACAAAAAGTCATACTTGAGTCATGTCATTTTAAAAATCCAAATTAAATATGAACTTTTTTTTTGGTCCG
GCCTATGGTAACTTGTAACATGTATCGAGTCGGATAACTCGTTTTGTTACATGTAAAAATAGTGTAAATCTATACTTAAACTTTAATTTCCACTCAACAAAATCAATTTCAACTTAAACA
AGTCTAGACTAACAACTATTTTTTATTGTGATAGTAGTAATATTGAAAGTTTTTGAAAATGTAATGACATAACATGCTTCTTTCACTGTTAATAGTATGGGGGTCCACACTACTGGTACC
AAGTATTGTTGGGCAGAAGAGATGCAAGAACTGCAAGCAAAGCTGCTGCAAACTCCAATCTTCCTCCTCCAACATTCAGCTTCTCACAGCTTGTTTCCAACTTCAAATCTCACGGCTTAA
ACGTGAGGGACCTTGTGGCCCTCTCTGGAGGCCACACCATAGGGTTTGCAAGGTGCACCACCTTCAGAAACAGAATCTACAACGTAAGCAACAACATAATAGACCCCACGTTTGCAGCAT
CTGTGAGGAAGACATGTCCGAAAAGCGGAGGAGACAACAACTTGCATCCACTTGATGCTACACCCACAAGAGTTGACACCACATACTACACGGATTTGCTGCACAAAAAGGGTCTTCTCC
ATTCTGATCAAGAGCTGTTCAAGGGAAAAGGCACAGAAAGTGACAAATTGGTGCAACTATATAGTAGAATCCCTTTGGCTTTTGCTAGAGATTTTAAAGCTTCAATGATCAAGATGGGGA
ACATGAAGCCTCTCACTGGGAGGCAGGGAGAAATCAGATGCAATTGCAGAAGGGTCAACTAG

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGAGGCTGGATGGCTTGTGGGTACCTTGTACCTTCACTTTATATAAGTCCTTTCTTTTGTTAGCAATGTTTTGTAACACCCAAACATATAACAAGATGGCTTCTTTTCATATCCAATAT
TCATTCCTTGTGCTTGTGCTTGCTATGGTGATCACATTGATGAACCCTACCAATGCAACCCTCTCTCCCCATTTCTATGATAAAGTTTGCCCTCAGGCATTGCCAGTTATAAAGTCAGTG
GTTCAACGAGCAATTATCCGTGAGCGACGCATCGGAGCATCTCTTCTGCGCTTGCATTTCCATGATTGTTTCGTAAAT
GGGTGTGATGGATCAATATTGCTAGATGACACCCGAAACTTC
ACTGGCGAGAAGACTGCATTGCCAAATCTTAATTCAGTCAGAGGTTTTTCTGTGGTTGATGAAATCAAAGCTGCGGTGGACAAAGCCTGCAAACGCCATGTGGTCTCATGTGCAGATATC
TTGGCCATTGCAGCCCGTGATTCTATAGCCATA
TATGGGGGTCCACACTACTGGTACCAAGTATTGTTGGGCAGAAGAGATGCAAGAACTGCAAGCAAAGCTGCTGCAAACTCCAATCTT
CCTCCTCCAACATTCAGCTTCTCACAGCTTGTTTCCAACTTCAAATCTCACGGCTTAAACGTGAGGGACCTTGTGGCCCTCTCTGGAGGCCACACCATAGGGTTTGCAAGGTGCACCACC
TTCAGAAACAGAATCTACAACGTAAGCAACAACATAATAGACCCCACGTTTGCAGCATCTGTGAGGAAGACATGTCCGAAAAGCGGAGGAGACAACAACTTGCATCCACTTGATGCTACA
CCCACAAGAGTTGACACCACATACTACACGGATTTGCTGCACAAAAAGGGTCTTCTCCATTCTGATCAAGAGCTGTTCAAGGGAAAAGGCACAGAAAGTGACAAATTGGTGCAACTATAT
AGTAGAATCCCTTTGGCTTTTGCTAGAGATTTTAAAGCTTCAATGATCAAGATGGGGAACATGAAGCCTCTCACTGGGAGGCAGGGAGAAATCAGATGCAATTGCAGAAGGGTCAACTAG

Retrieve as FASTA