Entry information : GmPrx65 (Glyma09g28460.1)
Entry ID 564
Creation 2005-06-21 (Christophe Dunand)
Last sequence changes 2011-07-04 (Qiang Li)
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2011-12-13 (Qiang Li)
Peroxidase information: GmPrx65 (Glyma09g28460.1)
Name (synonym) GmPrx65 (Glyma09g28460.1)
Class Class III peroxidase    [Orthogroup: Prx026]
Taxonomy Eukaryota Viridiplantae Streptophyta Fabaceae Glycine
Organism Glycine max (soybean)    [TaxId: 3847 ]
Cellular localisation N/D
Tissue type Hypocotyls
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value GmPrx65
start..stop
S start..stop
GmPrx282 605 0 15..328 1..310
LjPrx25 571 0 15..328 1..313
GmPrx14 532 0 15..328 1..314
PvPrx09 527 0 13..328 12..326
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 35426811..35427065 255 N° 2 35427970..35428158 189 N° 3 35428615..35428777 163 N° 4 35429523..35429902 380
join(35426811..35427065,35427970..35428158,35428615..35428777,35429523..35429902 )


exon

Literature and cross-references GmPrx65 (Glyma09g28460.1)
Literature Public Soybean EST Project.
DNA ref. Phytozome 12:   Gm09 (35426811..35429902)
Protein sequence: GmPrx65 (Glyma09g28460.1)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   329
PWM (Da):   %s   36166.79 Transmb domain:   %s   i13-35o
PI (pH):   %s   5.05
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MLCKPPLKCLKIVIMANLLTMFFVMEMIIVSGLSFGASGLNMNYYLLSCPFVEPVVKNTVNRALQDDPTLAAGLVRMHFHDCFIEGCDGSVLIDSTKDNTAEKDSPANLSLRGYEVIDDIKEELENQCPGVVSCADIVAMAARDAVFFAGGPVYDIPKGRKDGTRSKIEDTINLPAPFFNASELIKMFGQRGFSARDMVALSGAHTLGVARCSSFKHRLTQVDPTLDSEFAKTLSKTCSAGDTAEQPFDSTRNDFDNEYFNDLVSNNGVLTSDQTLYNSPQTRNIVNAYAMNQALFFLDFQQAMVKMSMLDVKEGFKGEVRKNCHKIN*

Retrieve as FASTA  
Remarks Complete sequence from genomic and 1 EST.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGTTGTGCAAACCACCTTTGAAGTGTTTGAAGATTGTGATCATGGCTAATTTGCTCACAATGTTTTTTGTTATGGAAATGATAATAGTGAGTGGTCTCAGTTTCGGAGCAAGTGGCCTG
AACATGAATTACTACTTGTTGAGTTGTCCTTTTGTTGAACCTGTTGTTAAGAACACTGTCAACAGAGCTCTGCAGGATGATCCCACCCTAGCTGCAGGTCTTGTTAGAATGCACTTCCAT
GACTGTTTCATAGAG
GTTCATTCTCTCTCTTCTCTTTCTTTCCCTAACACAAACAATCACTCACTCACACTTACGAGAAATTATTATATGATCCAGAACTATCATGATGTCAGACAATCT
CTATATATATCACACATAATTTAAGTTTTCTTTACTCTTTTTTGTAAATTGAAAAACTCAGACTATGTATTATGTGAATATTAGTTGGAACTATAGATAAATAATATGTTCTGAAACATG
TAATAAATTTCCCCACACTTAAAATAGATATGAATGAAACAGCATGGTGAAAAATGTTAGAGATGTAATGTAAAAATAAACATTTGTGTCTTCACTTAGTACTTTAAATTAACTTTTGAA
GTGTTGATTCATGACAAAATACTAGAATCTCTTTGACTTTGTGATCTTTAAGTTGATCCTTATCTAGCCCATTTTTCTAATGAAAAATTGAATTTCATTAGCATAGGGTAGTTGATGGGC
TCGTGTGTCTATATATACTTGAAGTTAGAAGGGTTATTGTGTGAGAGCAAATGTTAAAGATGTAATATAAATCATTCTTGTGTTTCTATACTAGGTTTTAATAAATGTTAATACAGTTGC
TTCATGACAAAGAAAAAGGAGTGGAGAGAAAAATGATTGAAGTAAACGTACACACACAAAAGCTAAGATACTTATATAAGCACACATGTAGATTAAAATGTACGTTTTGTTTGTAACTAT
TCGGGTCAATTAGTTGTATTTACGTAACTTATAAGATGCCATGTCAGTCTTTCAAGGGCAAATTAAACTTACTAAGTTGCATCCATTTTCTAAACTTATAAACTGCACACATTATTAACT
TAGCTTATAAGTAATTAAGTATTATTTCACGAGTATCATATATGTGTGGTGATACAAAGGGTTTATTTTTGTCTACTAGGGATGTGATGGTTCAGTTCTGATTGACTCCACTAAGGACAA
CACAGCAGAAAAGGATTCACCAGCAAATTTGAGCTTGAGAGGCTATGAAGTCATCGATGACATCAAGGAAGAGCTTGAAAATCAATGCCCGGGAGTGGTTTCATGCGCTGATATTGTTGC
CATGGCCGCTAGAGATGCAGTTTTCTTT
GTAAGATGAAGCTACTACACATTTCTTGTTCTGTACCTTATTCTCATTTTTTTGTGTGGCCCAAGTTGAATTTAATTTCAATACACTGTCAT
ACACAATTAATCAATTAGAGAAAACACCTTACATATAACTTATATAGTAATTATAACAAAAGTTAACATATCAATAAGGTCTAACACAGTTGATAAATGATTGAGTTTTTTAAACACACT
AACATAATTCAATTTCCTAAATGTGCGTATAAAAAAAATACTTTGTTGGGAGAGACAAAATTCACTTTGATGACTTTTCACTGTAGGGAAGTGAAAAAATAACAAAAAATTAACAATTTT
ATCCTTCATAGTCATTCATGTTTGGATAACCATGTAAAATACTTTATAGAGTGTATTCCAATTAAATTGTTAAATAATTACAATTAACTTTACCTAAACTTCTTAGTACCTATGACATGT
GCAGGCAGGGGGTCCTGTATATGACATACCAAAAGGTAGGAAGGATGGAACAAGGTCCAAAATTGAGGATACTATCAATCTGCCTGCCCCCTTTTTCAATGCTTCTGAGCTCATCAAGAT
GTTCGGGCAACGTGGGTTTTCTGCAAGAGACATGGTGGCTCTCTCAG
GTAATATAATATGCCTCTGTTTTTGCTATTTTACTATGAGTCAGAATAATTTAAAGAGAATTAACTAATTGAA
GTTTTAGAACATGGTTAATTGTTTGGTTGACGCACAGAGGAAAAAGACAATCATAAATGTGTGGATGGAATGTAGTGTAGTATATAAGAAGTAAATCAAAGAAATTGATTAATTCATTCA
GTCTGCAGGTTAACTTTGATAGGACTTCATACTTAGAATTATCCCCCATTAATTGTGAATATTCTTCCTACTCGTTTTTTTTAGGATCAAACTTGCTGATATTATTAATAAACATAAAAT
AATAGAGTTTATATAAAGAGAAATGATTTGGTTCAATTGAATTGGGACCTCCTTTAACCAAATAAGAAAAAAACTACAAATTTTAAGCAATCCGTGGCTTTATTTCCCTGTCTCTCAGGG
TTTACTTGTTTATAAAGAAAGAAAGCGGAAAAGAAGAGAAATGGACCGTAAAATAAGGTCAAATTCACCTTTTAACACTTTTTTTTAATTTAAAACTTTCATCTTAATTTATTTTTCCTC
TGTGGAAGGATCCTTAGTGAAGGTAAGGTTCTGATTCTTCTGAAGCGTTGATTTGGCAAGATACGCATGCAATCATCCACTAATTTGTTACTAAATTTTAGTAAACTTAATTAGCTAGGA
AGAGAAAAGCAATTTTCCATCACTAATTTGATAATTAATTTTTAGTAGTAATTAGAGATTTTGATTGTGCAGGAGCTCACACATTAGGAGTGGCAAGGTGTTCTTCGTTCAAGCACAGAC
TGACCCAAGTGGACCCAACTTTGGACTCAGAATTTGCAAAGACACTCTCCAAGACATGCAGTGCGGGTGACACTGCTGAGCAACCCTTTGACTCCACGAGGAACGATTTTGACAACGAAT
ACTTCAACGATTTGGTCTCAAACAACGGGGTTCTTACATCGGACCAAACGTTGTACAACAGCCCACAAACGAGGAACATTGTGAATGCTTATGCAATGAACCAAGCCTTGTTTTTCTTGG
ATTTCCAACAAGCAATGGTGAAGATGAGCATGCTCGACGTCAAAGAAGGGTTCAAGGGGGAAGTACGGAAAAATTGCCATAAAATAAATTGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGTTGTGCAAACCACCTTTGAAGTGTTTGAAGATTGTGATCATGGCTAATTTGCTCACAATGTTTTTTGTTATGGAAATGATAATAGTGAGTGGTCTCAGTTTCGGAGCAAGTGGCCTG
AACATGAATTACTACTTGTTGAGTTGTCCTTTTGTTGAACCTGTTGTTAAGAACACTGTCAACAGAGCTCTGCAGGATGATCCCACCCTAGCTGCAGGTCTTGTTAGAATGCACTTCCAT
GACTGTTTCATAGAG
GGATGTGATGGTTCAGTTCTGATTGACTCCACTAAGGACAACACAGCAGAAAAGGATTCACCAGCAAATTTGAGCTTGAGAGGCTATGAAGTCATCGATGACATC
AAGGAAGAGCTTGAAAATCAATGCCCGGGAGTGGTTTCATGCGCTGATATTGTTGCCATGGCCGCTAGAGATGCAGTTTTCTTT
GCAGGGGGTCCTGTATATGACATACCAAAAGGTAGG
AAGGATGGAACAAGGTCCAAAATTGAGGATACTATCAATCTGCCTGCCCCCTTTTTCAATGCTTCTGAGCTCATCAAGATGTTCGGGCAACGTGGGTTTTCTGCAAGAGACATGGTGGCT
CTCTCAG
GAGCTCACACATTAGGAGTGGCAAGGTGTTCTTCGTTCAAGCACAGACTGACCCAAGTGGACCCAACTTTGGACTCAGAATTTGCAAAGACACTCTCCAAGACATGCAGTGCG
GGTGACACTGCTGAGCAACCCTTTGACTCCACGAGGAACGATTTTGACAACGAATACTTCAACGATTTGGTCTCAAACAACGGGGTTCTTACATCGGACCAAACGTTGTACAACAGCCCA
CAAACGAGGAACATTGTGAATGCTTATGCAATGAACCAAGCCTTGTTTTTCTTGGATTTCCAACAAGCAATGGTGAAGATGAGCATGCTCGACGTCAAAGAAGGGTTCAAGGGGGAAGTA
CGGAAAAATTGCCATAAAATAAATTGA

Retrieve as FASTA