Entry information : GmPrx67 (Glyma14g12170.1)
Entry ID 566
Creation 2006-08-07 (Christophe Dunand)
Last sequence changes 2011-10-12 (Qiang Li)
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2011-12-13 (Qiang Li)
Peroxidase information: GmPrx67 (Glyma14g12170.1)
Name (synonym) GmPrx67 (Glyma14g12170.1)
Class Class III peroxidase    [Orthogroup: Prx028]
Taxonomy Eukaryota Viridiplantae Streptophyta Fabaceae Glycine
Organism Glycine max (soybean)    [TaxId: 3847 ]
Cellular localisation N/D
Tissue types Germinating shoots
Seedling epicotyls
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value GmPrx67
start..stop
S start..stop
GmPrx295 630 0 1..329 1..330
GmPrx151 510 0 16..329 13..326
MtPrx114 481 5e-173 1..328 1..322
MtPrx107 481 5e-173 1..328 1..322
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 10901046..10901273 228 N° 2 10902016..10902195 180 N° 3 10902295..10902460 166 N° 4 10903076..10903491 416
join(10901046..10901273,10902016..10902195,10902295..10902460,10903076..10903491 )


exon

Literature and cross-references GmPrx67 (Glyma14g12170.1)
Literature Public Soybean EST Project.
DNA ref. Phytozome 12:   Gm14 (10901046..10903491)
Protein sequence: GmPrx67 (Glyma14g12170.1)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   329
PWM (Da):   %s   35923.71 Transmb domain:   %s   i7-29o
PI (pH):   %s   4.75
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MEKGAMVFPFPIAVSCLFIIFHFANSVSGSLVFNFYAASCPTAEFIVRNTVSSSSSSDSSIPGKLLRLVFHDCFVEGCDASLMLLGNNTEKSDPANRSVGGFSVIESAKRVLEFLCPGTVSCADIIALAARDAVEIVGGPMIQIPTGRRDGMVSVASNVRPNILDTSFTMDEMINRFSDKELSLFDLVILSGAHTIGTAHCSSFRDRFQEDSKGKLTLIDKTLDSTYADKLMQECPLSASPSVQVNNDPETSMVFDNQYYRNLLTNKGLFQSDSALLRDNRTRKFVEDLANDQEFFFESWGQSFLKLTSIGVKTGDEGEIRRSCASTNA

Retrieve as FASTA  
Remarks Complete sequence from genomic and 2 ESTs.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGAGAAAGGAGCAATGGTCTTTCCTTTTCCAATAGCAGTGTCTTGTCTTTTTATTATCTTCCATTTTGCTAATTCTGTTTCAGGTAGCCTAGTTTTCAACTTCTATGCAGCTTCATGC
CCCACTGCAGAGTTCATTGTGAGAAACACAGTCAGTTCATCTTCTTCTTCTGATTCTTCAATTCCTGGGAAGCTCCTTCGCTTGGTTTTTCATGATTGCTTTGTGGAG
GTTAGTGTGTAT
TATTAGTTCTACACATGTTCTTTCACACTCTAGGTACTAATTTTTATTTGTAATTGTTAGGAATCTTGTCTTCTGTATTTTTCGTCTTTCCCTCTTGCGCTTGGATTGATCCTTTAGAGT
GAGTAAGGGTAAAGCGAGTAATTTTAGTCAATGATGAGAAAATCAATAGTTGATATAACAACACATGCATGATTTGTTATGCAAACGTACATAACATCAACTGTTGATTTTCTTATCAAT
AACAAAAATTACTCACTTTCCTATCTAAAGTAAGTTGTTCACTTTAGAGGAGCTGAATCCCTCTTGCACCTGGACTTGGACTAAAGTTAGTAATTTCAATTTTTTATGAGAAATCACTTT
AGAGGAGCTGAATCCCTCTTGTACCTGGACTTGGACTGAAGTTAGTAATTTCAATTTTTGATGAGAAAATTAATGGCTAATATATATAACAACACATACATACGATTTATTATAAATATG
TAAGTAACATTAATTGTTGATTTTCTATCAACGGCTAAAATTACTCATTTCACTTTAGAGGAGCCGAATCCCTTGCACTTAAGTCGGTTTTCTATATATATAACATTAATTGTTGAGTTA
GGCCCTAAACCCAAATTCTACCAAAATCTTACTAGGAATGTGGATTCTTCAGTTCTTGTGCTTTCTTTGCATGATGGAAAATTCAAATGGGTTTGAAGATGGTGATCAATAATTACTTCA
TGATATGTAGGGATGTGATGCATCTTTGATGCTACTAGGGAATAATACTGAAAAAAGTGATCCAGCCAATAGGTCTGTTGGAGGATTTTCAGTAATAGAATCAGCAAAAAGAGTCCTTGA
GTTCCTTTGTCCTGGAACAGTTTCTTGTGCTGACATAATTGCTTTGGCTGCTCGAGATGCTGTTGAAATT
GTAAGTTATCCACTTATCCCATTACATTGCTGATATTCTTCAAAAAATGC
ATTGACATCTAGTTTGGTATGGTAATTTTCTGAGGGCATTTGAAAACAGGTTGGTGGTCCTATGATTCAAATTCCCACAGGGAGAAGAGATGGAATGGTTTCAGTTGCTTCAAATGTCAG
ACCCAACATTTTGGACACCAGTTTTACAATGGATGAGATGATTAACCGCTTCTCTGATAAAGAGTTGTCCTTGTTTGACCTTGTCATCCTTTCAG
GTGCATATTCGTTCAAGTATACTAT
TGGCATGCTTCTCTTTAATAAGTCGTTCCTTTGATTTTCAGTCTCTTCCCCTGCCCTTTATTCTTAGAAGGGTAAATTGACCATGAGTTTCATCATATTTGAGGTTAAAAAAACCATAAA
GGCATAAGGCTAGACAATACATTCTGTTAGGTAGAAAGAATTGAATTATTGATGCTTTGTAGATGAGCACGTACTCCCCACATTTATTACAATTACTGTTCCTAGATGGTGGCTTGTTTT
TCTATCTAGTTTTTTTAATATTAAAAAACTGAATATGTTTGATATAAAAATTAATAATTTTATGGTATATAATATTTTGTGATTATATTAAATTTATAAAAGATTGTGAATCATTGCGGG
TGTATTTAGATTTCTAGCTGGAGGTTTCAAAAGTAAGTTTGAAAGTAAAATCAGTTTAGTTTGGGATCATATTTGATTACCCCAGAAGAATATGTTTAAGTTAAAATTTTGGCTTGAAAA
TTTAGTTTGGGAGAAGTAAAACCTGGGATACTTTTGCAAACTTTATTCCAAACATGGGATTAAACTTTTTTTCACAAGGTATGCTTCATAGTGATGCTTTGGCTTTGTAGGGGCTCACAC
CATAGGAACAGCTCATTGCAGCTCATTCAGAGATAGGTTCCAAGAAGACTCCAAAGGAAAGCTCACACTCATTGACAAAACCCTTGACAGTACCTATGCAGATAAGCTAATGCAAGAGTG
TCCCTTAAGTGCAAGCCCTTCTGTTCAAGTGAACAATGATCCTGAAACATCAATGGTCTTTGACAACCAGTACTACCGAAATCTTCTAACCAACAAAGGGTTGTTCCAATCTGATTCTGC
CTTGCTAAGGGACAATAGAACAAGGAAATTTGTGGAGGACTTGGCAAATGATCAAGAGTTTTTCTTTGAAAGTTGGGGCCAGTCTTTCTTGAAGCTCACTAGTATTGGAGTCAAAACAGG
TGATGAGGGTGAAATTAGACGTTCTTGCGCATCAACTAATGCATAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGAGAAAGGAGCAATGGTCTTTCCTTTTCCAATAGCAGTGTCTTGTCTTTTTATTATCTTCCATTTTGCTAATTCTGTTTCAGGTAGCCTAGTTTTCAACTTCTATGCAGCTTCATGC
CCCACTGCAGAGTTCATTGTGAGAAACACAGTCAGTTCATCTTCTTCTTCTGATTCTTCAATTCCTGGGAAGCTCCTTCGCTTGGTTTTTCATGATTGCTTTGTGGAG
GGATGTGATGCA
TCTTTGATGCTACTAGGGAATAATACTGAAAAAAGTGATCCAGCCAATAGGTCTGTTGGAGGATTTTCAGTAATAGAATCAGCAAAAAGAGTCCTTGAGTTCCTTTGTCCTGGAACAGTT
TCTTGTGCTGACATAATTGCTTTGGCTGCTCGAGATGCTGTTGAAATT
GTTGGTGGTCCTATGATTCAAATTCCCACAGGGAGAAGAGATGGAATGGTTTCAGTTGCTTCAAATGTCAGA
CCCAACATTTTGGACACCAGTTTTACAATGGATGAGATGATTAACCGCTTCTCTGATAAAGAGTTGTCCTTGTTTGACCTTGTCATCCTTTCAG
GGGCTCACACCATAGGAACAGCTCAT
TGCAGCTCATTCAGAGATAGGTTCCAAGAAGACTCCAAAGGAAAGCTCACACTCATTGACAAAACCCTTGACAGTACCTATGCAGATAAGCTAATGCAAGAGTGTCCCTTAAGTGCAAGC
CCTTCTGTTCAAGTGAACAATGATCCTGAAACATCAATGGTCTTTGACAACCAGTACTACCGAAATCTTCTAACCAACAAAGGGTTGTTCCAATCTGATTCTGCCTTGCTAAGGGACAAT
AGAACAAGGAAATTTGTGGAGGACTTGGCAAATGATCAAGAGTTTTTCTTTGAAAGTTGGGGCCAGTCTTTCTTGAAGCTCACTAGTATTGGAGTCAAAACAGGTGATGAGGGTGAAATT
AGACGTTCTTGCGCATCAACTAATGCATAA

Retrieve as FASTA