Entry information : GmPrx70 (Glyma18g06220.1)
Entry ID 569
Creation 2005-06-21 (Christophe Dunand)
Last sequence changes 2011-12-02 (Qiang Li)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2011-12-13 (Qiang Li)
Peroxidase information: GmPrx70 (Glyma18g06220.1)
Name (synonym) GmPrx70 (Glyma18g06220.1)
Class Class III peroxidase    [Orthogroup: Prx040]
Taxonomy Eukaryota Viridiplantae Streptophyta Fabaceae Glycine
Organism Glycine max (soybean)    [TaxId: 3847 ]
Cellular localisation N/D
Tissue types Hypocotyls
Mixed tissues
Roots of 'Supernod' plants
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value GmPrx70
start..stop
S start..stop
GmPrx92 585 0 1..317 1..315
GmPrx62 532 0 1..325 33..359
GmPrx120 525 0 8..325 6..323
GmPrx13 523 0 1..325 1..322
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 4808002..4808217 216 N° 2 4810185..4810379 195 N° 3 4811261..4811827 567  
join(4808002..4808217,4810185..4810379,4811261..4811827)


exon

Literature and cross-references GmPrx70 (Glyma18g06220.1)
Literature Public Soybean EST Project.
Protein ref. UniProtKB:   C6TEG1
DNA ref. Phytozome 12:   Gm18 (4808002..4811827)
mRNA ref. GenBank:   BT095984.1
Cluster/Prediction ref. UniGene:   Gma.3804
Protein sequence: GmPrx70 (Glyma18g06220.1)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   325 (300)
PWM (Da):   %s   35507.38 (32908.0) Transmb domain:   %s   i7-29o
PI (pH):   %s   9.48 (9.48) Peptide Signal:   %s   cut: 26 range:26-325
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MASNIQTLLVLVLATLGTFMIPSNAQLTPNFYKKVCPQALPIIRSVVHRAIIRERRIGASLLRLHFHDCFVNGCDGSVLLDDTHNFTGEKTALPNLNSIRGLEVVDEIKAAVDKACNRPAVSCADILAIAARDSVAILGGPHLWYGVLLGRRDARTASKDAANANLPPPFFNFSQLLSNFNSHGLDLKDLVALSGGHTIGFARCTTFRDRIYNDTMANINPTFAASLRKTCPRVGGDNNLAPLDPTPATVDTSYFKELLCKKGLLHSDQELYKGNGSESDKLVELYSRNPFAFARDFKASMIKMGNMKPLTGNKGEIRRNCRRVN*

Retrieve as FASTA  
Remarks Complete sequence from genomic and 10 ESTs. Unigene contains 1 EST from GmPrx92. Cultivar="Williams 82".
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTTCTAATATTCAAACTCTGCTTGTGCTTGTTCTGGCAACATTGGGAACATTTATGATCCCTTCCAATGCACAGCTTACTCCTAATTTCTATAAGAAAGTTTGTCCCCAGGCATTG
CCAATCATAAGGTCTGTCGTTCACCGAGCAATTATTCGTGAACGACGCATTGGAGCCTCCTTGCTGCGTTTGCATTTCCATGACTGCTTTGTTAAT
GTAAGTTATTTGTGTGTGAAATGG
TACATATGCATATGCTACTGTTCTTTTATACACACATATTGACAGTGATTTTTTTCATGTTTTCATACCATAAATTTAGACACAACTTGGTACTAATATTGTGGTCTAGTTTCCTATATT
TGTTAAAATCAAAGCTGAAAACTTGTTACTAATTACTATATGCATGGCCAATTAAAGCTTCCTAGCTATATCAATTTATATTTATGGTTTAATCAATAAAAGTCTTTCAGTTTTACCAGC
CAAAACCACATTATATATGTTGTAGCTTTTGCCTCTAGGTCACTATTGAGGTTGATATATGTTAATATCTCTAAATGATTTTTTTTACGGGTTTCTTAAACTTAAAGAACTAATTCTTAT
ACAATTTCATTATTGGAGTGACAATTCTTATATGAGAATTGTTGTTTATATAAACAACTGTTCTGATCTTAAGAATGTGAAACAATTATATTATATATATGACTTATAGTTCTTAGGAGC
TGTGCTGTTGGTTCTGTCAAAAACAAAAAAACAAAAACTGTACTCTTGGAGAAATTTTTTTATTGAAATTCTTAAATCTCATGTCACAATGTCGAGTATACTAGAAGTGGCTAAGCAACT
CCATCATAGATTCATAGTTGCACCATTGGAGATGTTCAAAAAGCTAAAATCCCTTCCTTCCACTTTTACAGTCAAAGTGCAATTTTATAACAAATTAAATAACCAATCCAGTATGTTAAA
CAACTTCATTTTGGTTTGATTTCGAAACTTCCAAAATTTGTGGCTTGTAATAAAATAACGATCAATTGAATTAGAATATACTTAACATGTGAAAATTTATACATTGTTATCTAATTATGG
ATTGATATATAATTAATTTTTGTTTATCATTTTGAAAATCACAAACAGTATAAAAATTTACGCATAGTATATGAAAGTTCAATTCATAAAATAATTGCTTCAAAATGCTATGAACTGACA
GGATGTTTGGGAATCATTAGCTAACTCATTTATTTTGCAGGGAAAAATTTGTTTATGGATGAAAATTATATTTATTATATTAAAATTTATTATGAATTACAATATTCGGTCTTTTGAAGT
TAAGCACATCTCAATTTTTAAGAAAAAAATATTTTAACTCTATAAAAAAATACCATTAATATATTATCATCCAAATTTTAACATTAAATTATTTTCAATATAATTCGAGATAAATTCATA
CCCTTTTATTGTAATTTGATTTGACTTGAAATTAAGCGTACATGATCACACTAGGTTCTTAAAATAGGCCGATTAAGTTTAGAAAATGAATATTTATCATATGANNNNNNNNNNNNNNNN
NNNNNNNNNNNCACACTACAAATATTATTGTAGTAATGTTTAAATAAATTAACCTGTTTAATCCAAAAGACTTAATCAAAATCTTAAAACTTGACGTATTTAATTGTTTTGACTTTCTAT
TTGTCCCATTTTTTTTTTATAATTATATCTAAATTAATAAGGTTTCGAGTAACAAAATTGAAGCCAGTTCAATTTCACTACAGCTTCAAATTAATTAAAGGAAAATAGAAACAAAAAATA
GAAAATAGAAAAAAGCGTAGATAATTAGATATATAATGGAGATAGGTGATATGAAGTGAAAGTAAAAAGTGTTATGGAAATATTTATAATGAATGGTTGTTTATGTATCATTACATATAA
ATCATAATTAAATTAAATTTCAATTTTCACTGATCAATATACGGTTAAACCTGAATTATTGTCAACCTCAATTACGTGTTGCAAAGTGATGAAATCATGTCCATCATAAAATAAAATAAT
CTAAACACCCATCAATTAAGAATTAACGGAAACATGCATCAACAGGCACAGGAACATGCATGTCATTTTCTATTAGATAACATTATAATTTTCTTTTTTATAATATACTAATTTGGTGAT
TTGTTGGATCCTTGGGAGCACAGGGTTGTGATGGATCAGTTCTACTGGATGACACGCACAACTTCACTGGCGAGAAAACAGCCCTACCTAATCTGAATTCAATAAGAGGTTTGGAAGTGG
TTGATGAGATTAAGGCAGCGGTTGACAAAGCTTGCAACCGTCCTGCTGTATCATGTGCAGATATCTTAGCTATAGCTGCTCGTGATTCTGTGGCCATA
GTAAGTATTGATTATAATTAAC
CAAACTTTTCTTTCCAGCTAGGAATTCTTAATTTATTTGTTGGGATAAAGTCTTTAATTAAGTTATATATTTATATTATTGTTATTATTATCGACTTCTTAAATTAAAAAATAAATTTAA
TTAAAATACTCTCGGTTACACAAAAAGATTCATGGAATAAAAATTATCTTTTGGACACTCAAAGTAAGTCTGTAGACGAGAAATTATTACATGACAGGAATTATTAGGACAAGTAATTGA
GTGTTATTATTCTATTTTTTTATATTAAAAAACTCAATTACATGTAATGTATAGATTGATTGGAATCATAAACGTGATGATTTATAACTTTGTAATAATTGCTCAGTTACACACTAGAGA
CTTAAGAAAACATGATAGAAAATGATTAATATGATGTGATAAAAGGAGGAATAAAGAAAAATAAAAAGTATCAATGAAACATTTGTATTGTTTGACTGCGAAAGAATCAAGACTTTTATC
ACAAATATTGTGGTGTTACAAATAGGAATTTGTCACCTCTTTGTCTCTATATCATATTTTACTTATTATATCTATCACTCGTTTTTTATTTATTTTTTCGTATATGTAATTAGTATTGTA
TCCGCGAAATATTATATTACTAGTAAAACCAGAGTTTAGTTTAGAGTAATATTTTTTGAACATTTCATTTTTCAAACACCTCAAACTCTTTTTATTTTCTTATCATATNNNNNNNNNNNN
NNNNNNNNNNNNNTTTTTTTTCTCAGTCACTAGGCATTGAGTAACATTTGGAGTGTACATGTAAAAACCATTTTTGGTTAGTTTATTCATTTCTTAAAGGGAACCCTAAAGTAGCACATT
GTCTTCCTGTTAACAACAGTTAGGGGGTCCACACCTATGGTACGGCGTGTTACTAGGCAGAAGAGACGCGAGAACAGCAAGCAAGGATGCTGCAAACGCCAATCTCCCTCCTCCATTTTT
CAACTTCTCACAGCTTCTCTCCAACTTCAACTCTCACGGATTAGACCTCAAAGATCTTGTGGCACTCTCTGGTGGCCACACCATAGGGTTTGCAAGGTGCACTACCTTCAGGGACCGCAT
CTACAACGACACCATGGCCAACATAAACCCTACTTTTGCAGCCTCTTTGAGGAAAACATGCCCTAGAGTTGGCGGTGACAACAACTTGGCACCGTTGGATCCAACTCCTGCAACGGTTGA
CACTTCATACTTCAAGGAATTGCTGTGCAAAAAGGGTCTCCTTCATTCGGATCAAGAACTCTACAAGGGAAATGGCAGTGAAAGTGACAAGTTGGTGGAGCTTTATAGCAGGAACCCTTT
TGCATTTGCTAGAGATTTCAAGGCTTCTATGATCAAGATGGGTAACATGAAGCCTCTCACAGGGAACAAAGGAGAGATCAGACGCAACTGCAGAAGAGTTAATTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTTCTAATATTCAAACTCTGCTTGTGCTTGTTCTGGCAACATTGGGAACATTTATGATCCCTTCCAATGCACAGCTTACTCCTAATTTCTATAAGAAAGTTTGTCCCCAGGCATTG
CCAATCATAAGGTCTGTCGTTCACCGAGCAATTATTCGTGAACGACGCATTGGAGCCTCCTTGCTGCGTTTGCATTTCCATGACTGCTTTGTTAAT
GGTTGTGATGGATCAGTTCTACTG
GATGACACGCACAACTTCACTGGCGAGAAAACAGCCCTACCTAATCTGAATTCAATAAGAGGTTTGGAAGTGGTTGATGAGATTAAGGCAGCGGTTGACAAAGCTTGCAACCGTCCTGCT
GTATCATGTGCAGATATCTTAGCTATAGCTGCTCGTGATTCTGTGGCCATA
TTAGGGGGTCCACACCTATGGTACGGCGTGTTACTAGGCAGAAGAGACGCGAGAACAGCAAGCAAGGAT
GCTGCAAACGCCAATCTCCCTCCTCCATTTTTCAACTTCTCACAGCTTCTCTCCAACTTCAACTCTCACGGATTAGACCTCAAAGATCTTGTGGCACTCTCTGGTGGCCACACCATAGGG
TTTGCAAGGTGCACTACCTTCAGGGACCGCATCTACAACGACACCATGGCCAACATAAACCCTACTTTTGCAGCCTCTTTGAGGAAAACATGCCCTAGAGTTGGCGGTGACAACAACTTG
GCACCGTTGGATCCAACTCCTGCAACGGTTGACACTTCATACTTCAAGGAATTGCTGTGCAAAAAGGGTCTCCTTCATTCGGATCAAGAACTCTACAAGGGAAATGGCAGTGAAAGTGAC
AAGTTGGTGGAGCTTTATAGCAGGAACCCTTTTGCATTTGCTAGAGATTTCAAGGCTTCTATGATCAAGATGGGTAACATGAAGCCTCTCACAGGGAACAAAGGAGAGATCAGACGCAAC
TGCAGAAGAGTTAATTAA

Retrieve as FASTA