Entry information : MtGPx06 ( Medtr8g098410.1 [4.0])
Entry ID 5697
Creation 2007-08-13 (Christophe Dunand)
Last sequence changes 2016-05-04 (Catherine Mathe)
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2016-05-11 (Christophe Dunand)
Peroxidase information: MtGPx06 ( Medtr8g098410.1 [4.0])
Name (synonym) MtGPx06 ( Medtr8g098410.1 [4.0])
Class Plant glutathione peroxidase    [Orthogroup: Gpx2001]
Taxonomy Eukaryota Viridiplantae Streptophyta Fabaceae Medicago
Organism Medicago truncatula (barrel medic)    [TaxId: 3880 ]
Cellular localisation N/D
Tissue types Leaves
Roots
Stems
Whole plant
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value MtGPx06
start..stop
S start..stop
PsGPx06 351 1.37e-124 8..230 1..229
LjGPx06 322 4.69e-113 1..233 1..236
PvGPx06 317 4.99e-111 21..234 19..231
AlyGPx06 304 8.05e-106 30..231 35..231
Gene structure Fichier Exons


exon

Literature and cross-references MtGPx06 ( Medtr8g098410.1 [4.0])
Literature Shaull S., Lin S., Dixon R., May G., Sumner L., Gonzales B., Cook D., Kim D., Roe B.A.; Submitted (MAR-2006) to the EMBL/GenBank/DDBJ databases.
Protein ref. GenPept:   ABE92133 UniProtKB_Uniparc:   Q1RY57
DNA ref. GenBank:   AC151526.19 (93958..97142) Phytozome 12:   chr8 (40887564..40890114)
Cluster/Prediction ref. Phytozome Gene 12:   31073535 UniGene:   Mtr.7779
Protein sequence: MtGPx06 ( Medtr8g098410.1 [4.0])
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   233
PWM (Da):   %s   25852.49  
PI (pH):   %s   9.64
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MLCSTSTTTRIRFISTTKRLLTAPLSSLLRFFSISTTLPNKPIIHKPLFTTLTPSLYFTLRRTDHTMASASNPQSIHDFTVKDAKGNDVNLGDYKGKVLIIVNVASQCGLTNSNYTELSQ
LYEKYKSKGLEILAFPCNQFGAQEPGSVEEIQNFVCTRFKAEFPVFDKVDVNGATAAPIYKYLKSSKGGLFGDGIKWNFSKFLVDKNGNVVDRYAPTTSPLSIEKDLLKLLDA*

Retrieve as FASTA  
Remarks Complete sequence from genomic (chromo 8, 5 introns) and 68 ESTs. Cultivar="A17". Tandem with MtGPx08.
DNA
Send to BLAST
CDS
Send to BLAST