Entry information : MtGPx05 ( Medtr7g094600.1 [4.0])
Entry ID 5700
Creation 2007-08-14 (Christophe Dunand)
Last sequence changes 2016-05-04 (Catherine Mathe)
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2016-05-11 (Christophe Dunand)
Peroxidase information: MtGPx05 ( Medtr7g094600.1 [4.0])
Name (synonym) MtGPx05 ( Medtr7g094600.1 [4.0])
Class Plant glutathione peroxidase    [Orthogroup: Gpx2002]
Taxonomy Eukaryota Viridiplantae Streptophyta Fabaceae Medicago
Organism Medicago truncatula (barrel medic)    [TaxId: 3880 ]
Cellular localisation N/D
Tissue types Flowers
Roots
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value MtGPx05
start..stop
S start..stop
PvGPx05 295 2.3e-104 1..168 1..168
EgrGPx09 291 6.41e-103 1..169 1..169
EguGPx09 290 2.5e-102 1..169 1..169
GaGPx05 287 3.36e-101 1..168 1..168
Gene structure Fichierperl './assets/cgi-bin/draw_exon.pl' '5700' 'join(37694705..37694758,37694885..37694961,37695174..37695235,37695400..37695518,37697024..37697191,37697659..37697691)' Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 37694705..37694758 52 N° 2 37694885..37694961 75 N° 3 37695174..37695235 60 N° 4 37695400..37695518 117
N° 5 37697024..37697191 166 N° 6 37697659..37697691 31  
join(37694705..37694758,37694885..37694961,37695174..37695235,37695400..37695518 ,37697024..37697191,37697659..37697691)


exon

Literature and cross-references MtGPx05 ( Medtr7g094600.1 [4.0])
Literature Torres-Jerez,I., Scott,A.D., Harris,A.R., Gonzales,R.A., Bell,C.J., Flores,H.R., Inman,J.T., Weller,J.W. and May,G.D. Expressed Sequence Tags from the Samuel Roberts Noble Foundation Medicago truncatula flower library
DNA ref. Phytozome 12:   chr7 (37694705..37697691)
mRNA ref. GenBank:   BI272177
Cluster/Prediction ref. Phytozome Gene 12:   31080367 UniGene:   Mtr.10313
Protein sequence: MtGPx05 ( Medtr7g094600.1 [4.0])
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   170
PWM (Da):   %s   19188.87  
PI (pH):   %s   9.53
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MGASHSVSENSIHEFTVKDARGKDVNLSTYKGKVIIVVNVASKCGFTNVNYTQLTELYSRYRDKGLEILAFPCNQFLNQEPGNSLEAEQFACTRFKAEYPIFGKIRVNGPDTAPLYKFLK
EKKSGFLGSRIKWNFTKFLVDKEGHVLQRYSPTTSPFSIENDIKKALGET*

Retrieve as FASTA  
Remarks Complete sequence from genomic (chromo 7, 5 introns). Cultivar="A17".
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGGTGCTTCACATTCGGTCTCTGAAAATTCAATCCATGAATTCACAGTTAAGAGGTAGTTACCTACTTTTTCTCAAACCCTTTAACTCTTTACTAAAAAAAACCTTTTTTTTTTGTTA
CTTTGCTTTTGAAGATTATTTTGAAAAACCTTTTTTTTTTTTTTTTTTTTTCCTTCTTACAGGATGCAAGGGGAAAAGATGTGAACCTAAGCACTTACAAAGGGAAAGTGATTATTGTAG
TTAACGTTGCTTCGAAATG
TGGTTCAACCCCACTTTCTCTAATTCAATTTTTTTGTTGTGTTTATGATAAAAATTCATTCTTTTTTTCTCTTTATGGTTTAATTGTTAGTGGGGTTTAGT
AATTTAATTAATTGTTTAATAGGGTTTTGCTAGTTTTTTAATTGGGGTTTAGTTGATTTAATTAGTTTTTAATAGGGTTTAGCTAATTTTGTTTATTGGGTTTTTAATTACAGTGGATTT
ACGAATGTCAATTATACCCAGTTAACTGAGCTTTACAGCAGATACAGGGATAAAG
AGGTATGATTTTTAAGGGTTTGAAGTACTGATTTTTGCATTTGGTGTTGAACTCTAAATTTTGTG
TTTTTGTTATGATTGAACCATTTTGAAGTTACTTAGACTGAAGGGTTTGAAGAAATTCTGAAATTGATTCAGTTGAGAATAATTTTGTTGGTTGATTTTAGGACTTGAGATATTGGCTTT
TCCATGCAATCAGTTTTTGAATCAAGAGCCGGGGAATAGTCTGGAGGCAGAGCAATTTGCCTGCACAAGATTCAAAGCCGAGTATCCAATTTTCGGAAAG
AGGTAATGTGCTGTTTGTTT
GTGTACAGAGTCTTGTTTCTTTACCTGATAGTTTTTCTGTCCTGGATGTTTTTGAGCTTATTGTTGAATGATTGAAACTCCAAAATGAATTAAAAGAAAAGAGTACAATGATTTTTTGGT
TTAGTTGTATTTATGATTTGTCATAGACTGTTAATCGGTTAAGTAATTTTAAGTTGGTCTATAACGGTCAGTAATCTTTTAGTGGGAAGATTTCACGTTGCAGAAGGCTTAATACTAAAC
CCTTCTATTAAACTTGTTATGTCATCGACCGAATACCATATAGGATTTACCGAAACTGTTGTCCATGTATAATAGGTCGTATTGATTGAAAACATAAATTAGGATTGTTGTATGCGAAAA
AAATCATTCTATCAAGACAATTCTTCTTTTTTAATGACTTGACTAGGTACTAGGATAAATTTCTTTGTTAAAAATCCACTCAAATGAGATTCAGGTCAATTTTTGAAAGAGTGTACCTTT
CTGTGTTTATACTTTTTTCTGAGCTTGCTTTTTTTTTGTTCTTCTTTTCAAAATCAAATCTCCCGGTTAATCATAATATGACAACTAGGAAAACTCAAGATTTGTCCAAAAAGATGAAAA
ATGCTAGCAAGACACTTTTGACAGTCATTTCAACACTTTCTATTATTGGGTGAAATCTCATGTGGACCCTATTAGTGATGTCCACTATCTATTAGCTGGATTTCACCTAACGAAGAGAGT
ATCAAAGAGTGTGCTGCTGACATTTTTCTAAAAAGGTTTCTACAATGATCACATCTTCTTACCTTGTCATACACAACTTTTCCAGAAATTATTGTCTCTTGGTAGTTCAGACCTTAGTTA
TTGTTTTCCGGTGACTCATTATTGTGTAAGTGTGCCCCTCATCGAATTAAAATTAGCTTAGATGACTAGTGTAAGTAGTTTACTGTAAATTATAGAATCCATTGGCGACGGATTCGGCCA
TGCACTTATGAAGCAATGTATTTCTTCATCTGTGTTTCACGCCTTACTTTACTCACATGTTTATCCAACCCTGCAAGTTGACTTGCTTGTATATCCTATTGACCTGTCCAATTCTATTGG
AAATTGAACTTGAAAAAACTGGTTCCTTTTGTTTTATTTTTTCTTTGCAATGAATTTTAGTGCTATGTATAAGTTAATTACGCCGTGTGCCATTACTGGATTGGTCTACAACTCTGTTGG
ATAAGTCTAGAGCTATATATTATTTGTTTCGAAAAGAAAAAAGCAAAGTAGCATCTCGTCAAATGAGCAACTATTCAATGTGTTGGTAGACGGAAATATATAGGGAAATTTGTCGTGGTG
TCAGCTAGGCTTCAAAATAATATGTCCTGCCTCTGAATGTTTATTCATCTTTACAAATGATGATTAGGAATACTCTTAAAAGCCTAGATAGTTCTGCATCTCTTTGCTATTTACAAACTT
TGCCATTGTTAGTTAACCATATATATTTGATTCGTTATTATTTGCAGATACGTGTGAATGGACCCGACACAGCACCTCTCTACAAATTCCTTAAAGAAAAGAAATCTGGTTTTCTGGGGT
CTAGGATAAAGTGGAACTTCACCAAGTTTTTGGTTGACAAGGAAGGGCATGTGCTCCAGCGTTACAGTCCAACCACCTCACCATTTTCCATAGAA
AAGTAATATCTCCCTCTCTATTTCT
CTCCATGTCTCTGTTATGTTCATTCCATTCTAATTTTGACATATCAACCGGCCTTAAATATTATGGGCCCCACCATTTATATGATTATCATCTCAACCTAAGATGTAAGGAGTGGACCCT
ATCATTTTTTAAGGCTAAAGATGTCAATATATGAATGGAGTGAGCATAATCTCACATGTTTTTCTAGGTGTATGCAATAATTTCTCATGTTGATGTGTATGCAACTAGAAGCTTAGGGCC
TGTTCACTTAATAGAAGGACAACTAGGCAGAATGTATTTTCAGAAACAATGAAAACAAAAACAATGTTTTGACATTTTCAAAATTTCTTAAACTGCTGAATCTATTTTAAAAAATTGTAA
AAAATAAAATAAAATGGTGAGCATATGCTGTTTTCATAAAACAAAATTGTTGGCTCATAAGTTTTTACATTGTTGCCTTTGTAGAATGACATCAAGAAGGCATTGGGAGAGACTTGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGGTGCTTCACATTCGGTCTCTGAAAATTCAATCCATGAATTCACAGTTAAGGATGCAAGGGGAAAAGATGTGAACCTAAGCACTTACAAAGGGAAAGTGATTATTGTAGTTAACGTT
GCTTCGAAATG
TGGATTTACGAATGTCAATTATACCCAGTTAACTGAGCTTTACAGCAGATACAGGGATAAAGGACTTGAGATATTGGCTTTTCCATGCAATCAGTTTTTGAATCAAGAG
CCGGGGAATAGTCTGGAGGCAGAGCAATTTGCCTGCACAAGATTCAAAGCCGAGTATCCAATTTTCGGAAAG
ATACGTGTGAATGGACCCGACACAGCACCTCTCTACAAATTCCTTAAA
GAAAAGAAATCTGGTTTTCTGGGGTCTAGGATAAAGTGGAACTTCACCAAGTTTTTGGTTGACAAGGAAGGGCATGTGCTCCAGCGTTACAGTCCAACCACCTCACCATTTTCCATAGAA
AATGACATCAAGAAGGCATTGGGAGAGACTTGA

Retrieve as FASTA