Entry information : GmPrx74 (Glyma02g40000.1)
Entry ID 573
Creation 2006-08-07 (Christophe Dunand)
Last sequence changes 2011-07-04 (Qiang Li)
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2015-12-16 (Christophe Dunand)
Peroxidase information: GmPrx74 (Glyma02g40000.1)
Name (synonym) GmPrx74 (Glyma02g40000.1)
Class Class III peroxidase    [Orthogroup: Prx013]
Taxonomy Eukaryota Viridiplantae Streptophyta Fabaceae Glycine
Organism Glycine max (soybean)    [TaxId: 3847 ]
Cellular localisation N/D
Tissue type Roots
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value GmPrx74
start..stop
S start..stop
GmPrx249 619 0 1..321 1..320
GmPrx330 519 0 1..320 1..320
GmPrx63 512 0 1..321 1..321
CclPrx113 477 2.43e-171 5..321 3..319
Gene structure Fichierperl './assets/cgi-bin/draw_exon.pl' '573' 'join(45203411..45203626,45204675..45204866,45205460..45205625,45205858..45206246)' Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 45203411..45203626 214 N° 2 45204675..45204866 190 N° 3 45205460..45205625 164 N° 4 45205858..45206246 387
join(45203411..45203626,45204675..45204866,45205460..45205625,45205858..45206246 )


exon

Literature and cross-references GmPrx74 (Glyma02g40000.1)
Literature Public Soybean EST Project.
DNA ref. Phytozome 12:   Gm02 (45203411..45206246)
Protein sequence: GmPrx74 (Glyma02g40000.1)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   320 (295)
PWM (Da):   %s   33940.55 (31052.3)  
PI (pH):   %s   6.97 (6.76) Peptide Signal:   %s   cut: 26 range:26-320
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MAFHSHGHIFSFSSILFCMFAMASSQLTSNCYESTCPQALSIIKTAVIGAVAKEHRMGASLLRLHFHDCFVNGCDASVLLDDTSTFTGEKSAAANVNSLRGFEVIDDIKTKVEAACPGVV
SCADILAIAARDSVVTLGGPSWNVGLGRRDSTTASKDAATTDIPSPLMDLSALISSFSNKGFNTKEMVALSGAHTTGQARCQLFRGRVYNESSIESNFATSLKSNCPSTGGDSNLSPLDV
TTNVVFDNAYFKNLINKKGLLHSDQQLFNSGGSTDSQVTAYSNDPSAFYADFASAMIKMGNLSPLTGKSGQIRTNCHKVN*

Retrieve as FASTA  
Remarks Complete sequence from genomic (3 introns) and 1 EST.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCCTTTCACTCCCATGGTCACATATTTTCTTTCTCCTCCATTTTGTTTTGCATGTTTGCCATGGCATCTTCTCAGCTAACTTCAAATTGCTATGAATCAACATGCCCTCAAGCTCTC
TCTATCATCAAAACGGCGGTGATTGGTGCGGTTGCGAAAGAGCACCGCATGGGAGCCTCCTTGCTCCGTCTTCATTTCCATGACTGCTTTGTCAAT
ATGCACGTTTTCTTTTAACATATC
CTAGCTTCACCTTTCTCACTGTCAATTAATCTCATGCATATATGTGATTAAATTTCGAACAATAATATATATTGGCATCATCAGCATTCATTTAGGCTCCTTTCCAAAATCTAATTAGTT
TTAGAGAAGCCCTAAAGTAGTCGTGTTTAAAGTGAGGGATTTGTTTTAGAAAGAAAAATTAGACATGTGTCAATCTTTAATGAGAAAATCATGAAAATATATTTTAATTATTTGATTTAT
TTTGCACATGCATGTTTATATTTTTTCTAGTCTAGTATCTCATATATATTTTTTTATCCAAATTAATCATATTCAAGTCGAATAAAATCATTATTTGATTAAATCGAAATAACTTCACAC
ATCACATGATTCATGTGTTTGGTGTGACGTATATATTGAATATAAATAATTGATTTTCCTACTTCCCATGTTGGGATTGTTTAAAATTCTACAAGTTTTATAAAAGTTTTGGTAAACCTT
TATACAAAATTACCGTTTTTATTCTTTTATACTAGCCATTTTTGTTATAAGTTTTTTCCCCCATTAATTATACATACACTGTTTTTCTTCTTATGCGTGTGTACGTGTAAGTACTCTACA
TGCATCATGCGTGATTCTTGTTTTCGGGTCTAACCTAACAAGCATGCATCCAGTCCTTGATAGGTATGAGTGTGAATTTTAAATTTAAACTGCTTTTTGTGAGTGGAAGAAAACAAAAAT
TGTTTGGCGTAGTAGTTGAAAGTTAATTGAATTTAATTATAGCACGCATGAAAAGAAAAGTTGACATGCACGTTCAGTTTAACCAAATAAGATTCACATACCTTCCTAGCTACATTGTTT
TGTCAAATTATAACTTAAGCTTTTAGATTAGTTAAAAATATTTCTTTACATCTTCGAGTTCTCTTGAAAATATAGCTAATTAAGCGTTATTTAATGCGGATTAGAAGCATGAGACATATT
AAATTAACTGCATTTTTAACTTTTTGGATATTAGTAATTAATATGTTACGGGATACAAACTTGTAGGGATGTGATGCATCTGTTCTGTTGGATGACACTTCAACCTTTACTGGAGAGAAG
TCAGCGGCTGCAAATGTGAATTCTCTGAGAGGTTTTGAAGTAATCGATGACATCAAAACTAAAGTGGAGGCTGCTTGTCCCGGAGTTGTTTCTTGTGCAGATATTCTAGCTATTGCTGCC
CGTGATTCCGTTGTTACA
CAGTAAGTTTATTAATTACAATGAACAAATAAAATCCAAAATGATAAACAAGATANNNNNNNNNNNNNNNNNNNNNNNNNNNNTATAGAACATGCCTCATTA
TAAAGTTTGATTAAGTTTCACTTACTCATTATAAATCAATGTACAAGAATGGTTTTAGAGTTCCAACTTAAAAAATTTCACAACACTATTTTTTTTATATCTCTTCATCTCATTATCTAA
CAATTTTTTTTCTCTTCTCGTCCTATTTATTTCCCTTATTGTAGAAAATGTTGTGAGAATTTTGGTAAGTAAAAATAGTCCTATATATTACACATGATTTTTATTTAACACTTTCATTTA
AACAAGACATATTTGAGATTGAAGAGTAAATGATGCTCGATCAGATTCTAATAATTATTTCAACTATTATTTAAAAAAGACGAGGATAACAACAAGGACGACAGCACTTTAGACCACAAG
GTTATAAAAGTTTTAAAAATACTAGCTACATCATAAACTAATTACTCCAAGAGCTTAAAATAATAGTAGGTAAAATTACATAAAACAGTGTTATATCTAACAATTGACTGGTATTTTGGT
CTTTGTATCTCAGTTGGGAGGTCCATCATGGAATGTTGGGTTAGGCAGAAGAGATTCAACCACGGCAAGTAAAGATGCTGCCACTACGGATATCCCATCTCCACTAATGGATCTCAGTGC
CCTTATATCTTCTTTTTCAAATAAGGGCTTCAACACCAAGGAAATGGTAGCTCTCTCAG
AGGTAAATTACTCACTAACTTTGACTTTAATTGATTAATTAATGACATTAATATAAGTAAG
ATTATGTGAACAATATTATCACACATATGAATCTTTATCAGTTAAGTNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNTAAATCTTATATCATTTTTTTTTCATGTATAAATAAATAGGAGCTCATACAACAGGGCAAGCCAGGTGTCAGCTATTCAGAGGCAGGGTTTACAATGAAAGCAGCAT
TGAGTCAAACTTTGCAACATCACTAAAGTCTAACTGTCCAAGCACTGGCGGAGACAGCAACCTTTCCCCACTTGATGTCACCACAAATGTTGTATTTGACAATGCTTATTTCAAGAACCT
CATCAACAAAAAGGGGCTTCTACATTCTGATCAGCAGTTATTTAATAGTGGTGGTTCTACAGATTCTCAGGTCACTGCCTATAGCAACGACCCTTCAGCTTTCTATGCAGACTTTGCTAG
TGCCATGATCAAAATGGGAAACCTTAGCCCCTTAACAGGGAAAAGTGGCCAAATTCGTACTAATTGCCACAAGGTTAATTGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCCTTTCACTCCCATGGTCACATATTTTCTTTCTCCTCCATTTTGTTTTGCATGTTTGCCATGGCATCTTCTCAGCTAACTTCAAATTGCTATGAATCAACATGCCCTCAAGCTCTC
TCTATCATCAAAACGGCGGTGATTGGTGCGGTTGCGAAAGAGCACCGCATGGGAGCCTCCTTGCTCCGTCTTCATTTCCATGACTGCTTTGTCAAT
GGATGTGATGCATCTGTTCTGTTG
GATGACACTTCAACCTTTACTGGAGAGAAGTCAGCGGCTGCAAATGTGAATTCTCTGAGAGGTTTTGAAGTAATCGATGACATCAAAACTAAAGTGGAGGCTGCTTGTCCCGGAGTTGTT
TCTTGTGCAGATATTCTAGCTATTGCTGCCCGTGATTCCGTTGTTACA
TTGGGAGGTCCATCATGGAATGTTGGGTTAGGCAGAAGAGATTCAACCACGGCAAGTAAAGATGCTGCCACT
ACGGATATCCCATCTCCACTAATGGATCTCAGTGCCCTTATATCTTCTTTTTCAAATAAGGGCTTCAACACCAAGGAAATGGTAGCTCTCTCAG
GAGCTCATACAACAGGGCAAGCCAGG
TGTCAGCTATTCAGAGGCAGGGTTTACAATGAAAGCAGCATTGAGTCAAACTTTGCAACATCACTAAAGTCTAACTGTCCAAGCACTGGCGGAGACAGCAACCTTTCCCCACTTGATGTC
ACCACAAATGTTGTATTTGACAATGCTTATTTCAAGAACCTCATCAACAAAAAGGGGCTTCTACATTCTGATCAGCAGTTATTTAATAGTGGTGGTTCTACAGATTCTCAGGTCACTGCC
TATAGCAACGACCCTTCAGCTTTCTATGCAGACTTTGCTAGTGCCATGATCAAAATGGGAAACCTTAGCCCCTTAACAGGGAAAAGTGGCCAAATTCGTACTAATTGCCACAAGGTTAAT
TGA

Retrieve as FASTA