Entry information : SbGPx05 (Sobic.006G272900.2 [2.1] / Sb06g033440 [1.4])
Entry ID 5736
Creation 2007-08-16 (Christophe Dunand)
Last sequence changes 2011-01-18 (Toky Ramarohetra (Scipio))
Sequence status complete
Reviewer Messaoudi
Last annotation changes 2014-08-06 (Messaoudi)
Peroxidase information: SbGPx05 (Sobic.006G272900.2 [2.1] / Sb06g033440 [1.4])
Name (synonym) SbGPx05 (Sobic.006G272900.2 [2.1] / Sb06g033440 [1.4])
Class Plant glutathione peroxidase    [Orthogroup: Gpx2001]
Taxonomy Eukaryota Viridiplantae Streptophyta Monocotyledons Poaceae Sorghum
Organism Sorghum bicolor    [TaxId: 4558 ]
Cellular localisation N/D
Tissue type Pollens
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value SbGPx05
start..stop
S start..stop
OsGPx05 317 5e-112 38..204 46..212
EgrGPx02 299 6e-105 18..204 15..202
EglGPx01 297 3e-104 18..204 15..202
ThasGPx03 295 3e-103 12..204 7..198
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 1807243..1807398 156 N° 2 1808411..1808487 77 N° 3 1809139..1809200 62 N° 4 1814700..1814818 119
N° 5 1822295..1822462 168 N° 6 1822535..1822570 36  
join(1807243..1807398,1808411..1808487,1809139..1809200,1814700..1814818,1822295 ..1822462,1822535..1822570)


exon

Literature and cross-references SbGPx05 (Sobic.006G272900.2 [2.1] / Sb06g033440 [1.4])
Literature Cordonnier-Pratt,M.-M., Suzuki,Y., Sugano,S., Klein,R.R., Liang,C.,
Sun,F., Sullivan,R., Eastman,A., Cannon,R., Kern,B., Morgan,J., Lucas,A., Al-Sheikh,A., Jones,V., Adibi,N., Owen,A., Gao,J. and Pratt,L.H. EST database from Sorghum: pollen.
DNA ref. Phytozome 12:   super_10 (1807243..1822570)
EST ref. GenBank:   CF481077
Protein sequence: SbGPx05 (Sobic.006G272900.2 [2.1] / Sb06g033440 [1.4])
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   205
PWM (Da):   %s   22582.94 Transmb domain:   %s   i13-35o
PI (pH):   %s   5.43
Sequence 246
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MIEATRGLRGPRLLLSVAVLVLAIALVFRSLTPAVPQMADDLPTSIYDITVKDIRGDDIELSEYAGKVLLIVNVASKCGLTSSNYKELNVLYEKYREKGLEILAFPCNQFAGQEPGTNEDIQETVCSRFKAEFPIFDKIDVNGKDAAPLYKYLKSQKGGFLGDGIKWNFTKFLVDKDGKVVERYAPTTSPLKIENDIQKLLGTAS

Retrieve as FASTA  
Remarks Complete sequence from 2 ESTs. Cultivar="BTx623".
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
TGATTGAGGCTACAAGAGGGCTCAGGGGCCCCCGACTCCTCCTGTCCGTCGCCGTCCTCGTCCTCGCCATTGCTCTCGTCTTCCGCTCCCTCACCCCGGCAGTCCCGCAAATGGCCGACG
ACCTGCCCACCTCCATCTACGACATCACCGTCAAG
GTAGGTGGTTGGTGCCTGCAGATCTGCTAGGCGTTATTCTCCTTTGTTTGCTCTCTGCTAGTTCCGCTGCTTATTGCTAGTTGAC
AGATTCGGGTTGTTTTCGCTACCGTAGTGAAAATCCTGAATTAGATTGGAGTAATTGGTGACAAGATGGTGGCTTTGCTGTTCCAGATACCTTATTTTCATGTGAAATCGAGTTTAGTAA
TGAAACCTGCACTGAGGTTGGATGTAAACGTGACGAGGTAGAAAAACTGAAATTTTGACCTGAGGGAACCGTTATCGTAGGGCCTGTTTAGTTTCTGCAGAACAGAATGTCATTTTGCAT
TCTGGGCCTGTGTTTAGTTTGCGAAAGAAAAAAATTTCGCGACACTGTAGCACTTTCGTTTATTTGTGGTAATTATTGTCTAATCATGTAACTAGGCTAAAAAGATTTGTCTCTTAAATT
TCGACCAAACTGTGCAATTAGTTTTTATTTTCGTCTATATTTAATACTTCATGTATGCGTCTAAAGATTCGATGTGACAGGGAATCTCGAAAATTTTTAGGTTTTTGGGTGGAAGTAAAC
AAGGCCCAGTATTTTGGACCCTAAAAATTTTGGCATTTTGGATGAAACAAAACGCACCCATGAAAAATTTGGCATTTTGAATTTCATCATTCCAAAGTATTTGGTATTTTGTATTTTGCA
TTCTATAGGGAACTAAACACACCCTTAATTCAATTGCGTGGAACTCTGTTTCTCTCACTGCAAAGATGTACTGTTGGGTGGACCTGTCAAAAGTGAAAAAGGTATCATTTGTCCTTATCG
CAATAGATATATATGTGCCTTTTTCTCTTCTTTGCGTCATTCTATCAGGAAGTTCTGCATCTTTTGCTGGCACCCAGTACAGTAAACATAGGCAAAAATTTTCTTCAAATGTTGTAGCTG
TGCATTGTTACCTGTGACCTCAATTTACATATTATGGTCTTTGTCTTTGCCGATTTGTTTCTGAACTGATATTTTGTTCTTGTAAAGGATATTAGGGGTGATGACATAGAACTAAGCGAG
TATGCTGGAAAGGTTCTTCTTATCGTCAATGTTGCTTCAAAATG
GTAACTGTTGGTCTGAACTTCATTGTTTAACATTGCGATCTAGCCTACATCAGATCATATTGCACATTCTTTTAAA
AAAATATTTCAATGGTCTTCTGATGAAAATGGATGTTCTTTTCTCCAGGTTTCAATTTTTTCTTTTGAGCGAATCTACTTGTTAATCTTTAGAGCAGTTGAAATGAATACTATATCCTCC
CAAGTCCCAAGGTTATTCATCATGCTGTATCTATTTTCCTTGATATGATAGGGCTATCTTTCATCTGTCTTGAACTCAGCTTGTCCTATGAATCTGAGGTACTGTACAGTATAGATAGAT
TCAGCTATAGCTCAGAACCAATGGCTTCTTTGTGGGCCTTTCAGGAAGGCGAATCTGGCATTTTATATTCTGTTCTTAGGCGGATGCATGTTTTTCCTTGTTGGCTATAAATATACACAT
GTTACTTACTATACTGCAGACTACTGATGTTGTAAACAGGTCAGTCTGGTGTAGCAAACCTGTGCTTTGTTGTACATCTTTTCCCTTGTTCAAGTCATAGTTGTAAGACTGAATGAAGAT
GCCTCAGAAAATAGATGCTAGAGCTATGTTTAATTTTATTTCACAGTTGAAGCATATGTGGAACTTGTGGTTCATTGGTTTTACTTATTTTGTAGTGGACTAACAAGTTCCAATTACAAA
GAGCTAAATGTCTTGTATGAGAAGTACAGAGAGAAAG
GTTTGTTCTTTGACTATAGCGTTCTCATGCATAATTGTAAGAGAGATAAACTCTGTATATTCTATATTGATTAAACACAGATT
ACAGGGGATTACAATATAAAGGCAGGAGGACTCAAGGGTTCAAGATGTGAACATAATCTAGGAACCTAATTAACTCATACTAAATAGCACAAGTGCCTAGGTTGGCGCATGGCTGTACCC
AGCAGCCAAAGCGCAGGCACAATAGACTAGGAGGCAAGTCATAACTTGCTAACATCCCCCCGCAGTCTGAGCGTCGGTGCAGCGGACGTTCAGACTGGTTCTAAATTCTGCGAAGAGCGA
AGATGGCAATCCTTTGGTGAAGATGTCAGCATACTGAGAAGTGGTTGGGACATGAAGAACACGAACAGCACCAAGAGCAACCTGTTCCCGGACAAAATGGAGATCAATCTCGATGTGTTT
AGTCCGCTGATGTTGGACAGGGTTGGCGGACATGTAGACGGCGCTGATGTTGTCACAATAGACCAATGTAGCACGCTGCAAGGGGGACTGCAATTCGCTGAGAAGTTGGCGCAGCCAGGA
AGTTTCTGCAACAGCGTTGGCAACGGCGCGATATTCAGCTTCGGCACTGGATCGGGACACAGTGTTTTGGCGTTTGGAGGACCAGGAAATGAGGTTATCACCAAGGAAGACCGCATATCC
AGAGGTGGACTTGCGAGTATCTGGGCAGCCGGCCCAATCAGCATCAGAGTAGGCGATCAGCTCATGTTGTGACGAGGGGCGGAGCACCAGCCCCAAATGTAGAGTACCGCGAACATACCG
AAGGATCCGCTTGAGGGCAGCCAAGTGAGGTTCCCGTGGATCATGCATGTGGAGACACACTTGCTGAACAGCGTAAGCAATGTCCGGACGAGTAAAAGTGAGGTACTGGAGAGCACCGGC
TAGGCTGCGAAAATCAGAGGGATCCTGAACTGGGTCTCCACTTACTGCAGATAACTTGGGATTGGTGTCAACTGGAGTAGAGCAGGGTTTGCATTCAGCCATACCAGCCCGGTCAAGAAT
CTCCAGCATGTATTGTTGCTGAGACAAGAACAGACATCCATCCCTGTGCTGAACTTGCATTCCAAGAAAATGGTGTAACTTGCCAAGATCCTTCATGCTGAACTCACGCTGTAGGGCAGC
TATGATGCGACGGAGGACAGCTGTGGAGGCAGTGAGGATGATGTCATCCACATACAGTAGCAAGTATGCTGTGTCGGCACCATTATGGTAGATGAATAGAGAGGTGTCTGCCTTTGCATT
CACAAATCCAAGGGAGAGAATAAATGTGGCGAAGCGACTGTACCATGCCCGAGGAGCTTGCTTGAGGCCATAGAGAGACTTGTTGAGTTGACAGACATAGCCGGGGTGAGTGGAATCCTC
AAAACCAGCAGGTTGTGCAGCAAAAACAGTTTCAGACAGGGTCCCGTGTAGGAAGGCGTTCTTTACATCGAGCTGGTGAACTGGCCAGCCACGGGAGAGGGCGAGGGAGAGCACTGTCCG
AACTGTGGCGGGCTTGATAACAGGGCTGAATGTCTCGTCAAAGTCGATCCCAGGGCGCTGAGTAAAGCCTCGGAGGACCCAACGAGCCTTGTAGCGCTCTAGTGACCCATCAGCCCTGAA
TTTGTGCTTGAAGATCCATTTACCAGTGACAATGTTGCCTTGAGACGGTCGAGGAACAAGCTCCCATGTCTTGTTCTGAAGGAGAGCAGAGAACTCTTCTTCCATGGCAGTCCTCCAATT
GGGATCAGCAAGGGCACTACGGAAGCTGCGGGGCACCGGTGACAGTGTTGTGCTGTTGTAGACACTAGGAAACCGGTGACCAGCTTTCGCGCGTGTCGTCATGCTGTGATTGTTGATGGT
GGGCTGCATAGACACGGCTCCCTTGGGCAGAGCCGGCGGGCTGGGGGCAGCCGGTTGCGGAGGAGGAGCGGCTGCCTGGCGCCGTGAGTACACCAGTAGTGGTCGAGGCTTGACAGGGGC
TGCAGCAGCAGCCGCAGGTGTAGAGGAAGCTGCCTGCCGGGCTGCAGCAGCGCCCGGAGCTGCAGCAGCAGCAGGTGTAGAAGGAGTTGCCTGCCGGGCGCCTGATATCAGCGAAGGAGC
CTTGCCCGGTACCGGAGTGGTAGCTGTTGTCTGGACGGCTGCACCCTCACTGACTGCCACACGGGGACAGTCCGTGCAGGGTGCTGACAGTGTGCTGACACGGGGGCTGCACGGGGCCGT
GCAGGAACACCAGTGGAGGTACCTGTAGGAAAAGGTAATGGTACACTGGGAAGGGGATCAGCATCAGAAGTTAGAAAATCAAAATCCGCTGGATTGGAAGGAGTGTGCTGCTGAGAAAGG
GGGAACGAGGTCTCATCAAAAACGACATGCCTAGAGATGAGAACACGATTGGTTTGTAGGTCGAGGCAGCGGTATCCTTTATGGTTGGAGGAATAGCCAAGAAAGATGCACAAGGAAGAT
CGAGGTGCAAGTTTGTGGGTGGCTGTAGCGGAAAGATTAGGATAGCAAGCGCAGCCAAAGACGCGAAGATGGTCGTATTGGGGCTGAACACCAAACAGGACAGAGTGAGGTGTGGATGAG
TGAAGGGTTTTGGTGGGTAGGATGTTGAGAACATGTGTGGCGACATGCAGAGCTTCAACCCAGTATGAAGGGGGCATGGAAGCTTGAAAAAGAAGAGAGCGAACCGCATTATTGATAGTG
CGGATCATGCGCTCAGCCCGCCCATTCTGAGAGGAAGTATATGGACAGGACATGCGAAGGTGGATGCCTTTGGTGAGGAAGAAGGAGCGGGAGATAGAGTTATCGAACTCCCGGCCATTG
TCACATTGGACAGCTTTTACAGTGGTGCCATACTGAGTGTGAACATAGGCGAAAAAGTTAGTTAAAGTGGTAAACGTGTCAGATTTGAGACGAATTGGAAACGCCCAAACATAGTGAGAA
TAATCATCGAGAATAATTAAATAGTATTTGAAGCCAGAAACACTAATGACTGGGGAAGTCCATAAATCACAGTGAATGAGCTCAAATACAGTGGAGGCCCGAGAAGATGATGTTTGAAAC
GGAAGGCGAGTATGACGCCCTAACTGACACGCATGACAAATAGGATCAAGTTCTTTGGTACAGCCAGGAATAACAGAAGTGACTTTAGACAGCGTGTCACGACCAGGATGGCCAAGTCGA
CGATGCCAAATTGCAGGTGAAGAAGCAGCAGCAAGGGCGGTGGCGCCGGGGAGATGTAATGGGTAGAGGGCCCCGGAGCTATTGCACCTGATGATCACCTTCTGAGACTCCAGATCCTTC
ACAGAGCAACCAGCAGGGTCAAATTCAACAGCACAATTGTTGTCAGTGGTGAACTGGTGTACTGAAATGAGGTTTTTAATGAGGCGTGGTGAAACAAGAACGTTATTAAGGGACAAAGAA
TCAGTGAGATTGGTGGTGCCAGTGGCTGTGACAGGAAGTAAAGAGCCATCACCAACAATGATAGAAGAAGGAGAAGGATGCTGTGAAAGGTTAGTGTGTGAAAGAGTGCGAGAATCAGAA
GTCATGTGGGAGGTGGCACCTGTACCAGTCGTTGTTCGGCGGCTGCTGTAGTGTCATGGTGCTGAAAGTGGAAGCAAGGGACTGCTGATCGAAGGCCGCCGGAAGACCGGGTGGAGGGGT
GTAGAAGCCGGGAGGAGCCGAGCTGCCAAAGGAAGGCACATGAGCACCCTGCTGACCGTAGAAGGCAGCAGGAGGGGCCTGCTGCAGGTACTGCTGCTGAAACGGTGTTGGAGGGTGCTG
CTGCGAAGCCAGGAAAGCTCCCTGTTGAGCCAACAGTGCCTGCTGGTGTGGTGGATGGGTGGGTGCACCGCGAGGCAGATTACGCGGCCCGGGGACAATGAGCCATGGGTTGTAGTGGGT
GGGCCAAGACCCACTCGGTCCCTAGTTGGGTGCAGCAGATGTACCCGCGCCACCGCCTTTGCCACCCTTGTGGCCAGTGTTGCCACCTCGGCCCCGAGCGCCGCGACGATTGTTTTTGCC
ACCAAAGCCGCCCCCTTTGCCGCCCCCAGGGTCGGTTGTGGGGTGCCCAGAGGTCTGCTGGGGGGCGGGACGAGGGGACGAGGAGCCGCTGCCTGTGCTGACGACGAGAGCCGTGGGAGG
AGACGGAGTCGGGCCCCCCATGGTAAGCTCCTCGAGGGTGAGCTCATCACAAGCCTCCAAGAAGGAAGGGAAGGGACGGCTGCGTCGAAGATGGCGGCCAACGGAGACAAATCGCTCGTT
CAAACCTCGGATGAGATTGAGGACGAGGGAGCGGTCGCTGACGGGTTCTCCCAGATCAGCGAGGTTGTCGGCGGTGGTCTTGAGAAGCTTGCAGTAGTCGGTGACGGATAGGTCCCCCTG
GACAAGTGTGCGGAGTTTGGCATCAAGGATGAGAGCACGCGCCTCCCGGTTGCCGAGGAATTGGCTCTCAATGGCAAGCCAGGTGGTACGGGCAGTGTCGCCTTGGTCGCCGCGATGCCG
GACGATGTCATGGAGATTGTCGGAGAGGGTGCCGTAGAGCCAGGAGCGGACGACGCAGTCCATGCGCTCCCAGTCCGGCGAGTTCAGGGGACGGTCGTCCTGAAGAACGTGGTCCTGAAG
AGAGTACTTGCCCAGGGCGAGCAGGAATTGCTCGCGCCACCGAGCGAAGCTGCCGGAGGTGACGTCGAGGACGACGCGGACAAGATGGCGGATGTTCTGGACGGCCACTGCTTGGGCGTG
GAGGTTAAGAACAGCAGCAGCCTCCTGAAGAGCAAGGGCGGCCTGAACAGAGGGACGAGGGCCATCGGAGAGGGAGGATGCGACCTCCTCGGGGTCCTCTGGCGGGTCCGCAAGATCCGC
CGCGGCCCGCTCCTGGGCCGCGCGCTCCAGGGCGGCGCGGACGCGCGCGGCTGCAGCGTCGCGCTTAGTTGCCGCCGCCGCGGCCTCGGCTTCGGCCTCTTCCGCGCGGGCGAGGGCGGC
GCGACGGGCGGCGCGGGCGTCCTCCTGGCGCTTGCGCTCGACCTCGTCAGCAGCAGAGGGGTGGAGTGATCCCGCCATGGCGGAGGAGGGAGGGGCGGCGCTAGGAGCAGCACGCGGCGG
CGCTAGAAGCGGCGCGCCAGGGAAGCGGAAGGAAGAACGGGGGTTACCCGGACTCGTGATACCATGTAAGAGAGATAAACTCTGTATATTCTATATTGATTAAACACAGATTACAGGGGA
TTACAATATAAAGGCAGGAGGACTCAAGGGTTCAAGATGTGAACATAATCTAGGAACCTAATTAACTCATACTAAATAGCACAAGTGCCTAGGTTGGCGCATGGCTGTACCCAGCAGCCA
AAGCGCAGGCACAATAGACTAGGAGGCAAGTCATAACTTGCTAACAATAATCATACCTGAAATAATAACAAAATATATATTTTATCAAAATGAATTTATCTCATTTTCCATGGCTTCCTT
TCACTCTTACATGTAGGCCTTGAGATACTTGCATTCCCATGTAATCAATTTGCTGGTCAAGAGCCTGGCACCAATGAAGATATCCAGGAGACAGTTTGTAGCAGGTTCAAAGCAGAGTTT
CCTATTTTTGACAAG
GTAAGCAATTTGACCTGTGAGTTTTTCTTTTGCAGTAACTAACGTATTATGAATTCGGAGTTTTCTATCATACATCTGAACTAGATATTACCCCGCACGTTGTTG
TGGGAACTTTATTATGCTGTATAGAAAGAAATTGTCGAGTAGTACATCCGGAGCATCAAAATTCTCTGGTGGCTGAGGACCAAATCTTAATCACTTTATCCATCGAAAACCTTGAAAATC
TCAATAGTCCTAACTTGGTATGAAATATGATGCTAGAAAATATTGCTCGCGATGTCTAATGTCAATTGGATATTATTTTATGATTAGTCATGGCAAGCAAAACTACAATTTAGCCGTTGT
GCAGATTGCACGGCATGGTTCAAGAATTTTGGCTTTAAATAAATGTGTACCTTATTGATGAAGATAATCCTGTTTAGAAATTAAAGGATGATTTCCGTGATGCAAAGCTAATATATATGC
GGCCCGCAGCCGTTGCCAGCACAGCAGTGCCACACAGCTGCAGCGGGCTCACTGGATGTTTCAGTGGCATGCGGTGGTGAGCTTTGGCCACCGCTGCCGCTCCAGGCCACAGTGACCTTG
GCATGGCATGGATTCACCGCCGCCCATCCCCCGGTGTGGCCACCGCGACACCGATACGCAGCATGTCGAACTCGATCCGGCAATCCGGCATCTACCATCGAAGGCACAGGCAGGACTGCC
GCATCCGTCACTCCCAGTTGCTGCTGCCGCCTGGCTGCCGTTGCCGCTCGTTGAGTGGGCAAAGGTCTGCCGCTTTTTTTCCCTCTCGATCAGGCCGTAGCCTGTTTTCAATGGCCTGCC
GCCTCGAACAGGGAGTGCCCTCCTCGCCCTGTTTGCACCAATTCAGCCTCAAGCCTGGTGAGCCGCATGCTGCAACAGATGGGTGTGCAACAACCGCCGCAAAAAGCCGGCCGTGTATAC
AGCCACTGTCAATGGATGGTGTGGTCACATCAAGCCACCACCATGAGCCGCGTGCATCCGTGCCATGCTCACCGGATGTAGTATGCCTGGTGGTCAGGCTCAGGAGGATTGCATGTGGTT
GGCGAAGTTCCAAGGTCTACTCTTGGAACTGAATGACTGCTCAAATCCCTCCACTTTCTAGCAGTTTTATTTTGAATTTATTAGAGAATAGTGCCGTAGTGGAGGATGTGGTCACGTATG
TTATGACCGGCCAGCACTACTCCAGGCGTAGCCGGCCTGTTAGGGGCTAAATAGGCCTGTATTTATTTAATTTCGAATTATTTCATATTATTAGTGATTACTTCAGGGGTTATTTAGCAA
AAGACAATTAGATAAATACTCTATAATTTGGATGATTGAGATTGAGCAGAACCATCATATTGTTTCGGCTTCCCTTGGGAGCCAGGAGTCCTAAGCCCAAGCCGCCAGCCCCTGTTCTTC
CCACGCCCACACGACGGCACCTTGCCGCTGTTCCTCCTTCAAGCCACGTCCAGCCATCACTTGTCATGTGGGGCCAGCCGTACGTCAGGCGCCGGCGCAACCGCGACATCCGCCGAGCTG
AGGAACGCGCCGCGCGCGCACTAGAGGAAGAGGTCCAAGCGGGATTCGAAATTAGTGGCTAGTAAATATTAGTGTTAGCTATTTTTGGTTAGTCCTAAACTCAAGGAGAGATTGTTAGTT
TCCCTTTCATGCAAGCCGCAGCTGAGGAACGCGCCGCGCGCGCGCAAGAGGAAGAGGTCCAAGCGGGATTCAAAATCAATGGCTAGGAAATATTAGTGTTAGCTATTTTTGGTTAGTCCT
AAACTTAGTTTCCCTTTCATGCAAGCCGGATGGCTATTTGTATTCCCAAACATTCCCGTGAGTGAAAAAGCAAGATCAACAACCAAACTCTCTCTTCCTCCCTCGAACATTCTCAAGCCT
AGAAGCCGAGAGGGGCATAACCTCCGTTCTGGAAGACACGGCACGAGACTACGAGCTACGTAGTCGAGGGCCGGCTACCCTAGATCACCAGGCCCTTGACAACCTGGTATCCCGATCCAA
TCGATCCTCGGCATCCTCAGCCGCCGCGCCATCATCTCCGACACTAGCAGCTACACCAAACCCATCGCCCACCCGTTCCACAGCCTCCACCGCAAATCCCAGTCCACCGCCATCTCCCAC
TGCCCCCGCAACCATCCCAGCCGCCATGGCTGAACCCACCCTCGCCGAGGTCATGGACATGCTCAAGTCCATGCGCATGGAGATGTCCACCCTCAAGTCCGACGTGGCGACCATGAAGGA
CAAGTCCTCATCGTCTTCCGGCGGCGGCGACGATCGTCGTTCTGAAGGCCCGCGAGATCAGGACTTCCACCCCAAGCACAAGAAGTGGGATTTTCCCCGCTATGACGGCACGACCGATCC
GATGCTATTCCTCAACAAATGTGAGGCCTACTTCCGCCAACATCGAACCATGGCGGAGGAACGGGTGTGGATCGCGTCGTACCACCTCGACGACATCGCACAACTGTGGTTCACGCAGCT
CCAAGACGACGACGGCACGCCGACGTGGGGGCGCTTCAAGGACCTCCTGGACCTGCGGTTCGGACCCCCCCTCCGCTCCGCCCCGATGTTCGAGCTCGCCGAGTGCCGGCGCACCGGGAC
GGTGGAGGAGTACTCTAACCGTTTCCAGGCTCTCCTACCGCGCGCGGGTCGCCTCGAGGAGGCCCAACGTGTCCAACTCTACACGGGGGGACTCCTTCCGCCGATTAGCAACGCTGTCCG
CATCCACAACCCCGGTACGTTGGCGGCGGCCATGAGCCTCGCATGCCAGGTGGAGATGATGGAGGCCGAGAGGCTGCCTCCCCACCCCCCTCGGGCGCCCCCGCGCGGTATCCCTCCGGC
GCCAGCACCACGACCTGCACTACCGGCGCCACCACCGATCTTGCAGCTGCCAGCACCTTCGGTGGCCTCTCAGCCGGGTCGGGGCGAGGGAACACAGCGACGCCTCTCTCCGGAAGAAAT
GGCGGAACGACGCCGCCAAAACCTATGCTTCAACTGCAACGAGAGGTACAACCGTGGTCATAACAGGTTCTGCAAGCGCATTTTCTTCGTCGATGGCGTCGAGATCGACGACGAGCCAGA
AGGCGAGGCGGCGGTCACTGCCATTTCCGGGGAGGTGGAGGCACCGACTTTCTCCCTCCATGCGGTCGCGGGCGTGGCCATCGGCAAGACCATGCAGGTCCGCGTCTCGGTGGGCGCGAC
GTCCCTCATCGCCCTCCTGGACACGGGATCCACTCACAGCTTCATCGGCGAGGAGGCCGCGCACCGGACCGGCCTGCCGATCCAACCTCGTCCGCGCTTGACGGCCACGGTCGCCAATGG
CGAGCGCGTGTCATGTCCAGGCGTCCTCCGCGGCGCCCCGCTGCTCATCGGCGACTTCCACTCCACCGTCGACCTCTTTGTCATGCCTCTTGCAGGATACGACATTGTCCTAGGGACGGA
CTGGATGGCGACCCTAGGACAGCTGGTGTGGGACTTGGTCGCGGGCACCGTCTCGTTCCAGCACGCGGGACGCGCCGTGCGCTGGTCCGCCGTGCTGGCCCCTGGCGCCCTTGGCCCCTA
CACCACCACGGCCAGCGACTCGCTCCTGGAGGAGCTTCTGGCGCAGTTCGACACCGTCTTCGCCGAGCCGACCGGCCTACCCCCTCCCCGAGGCCGCGAACACGCCATCACACTCAAGCC
GGGCGCGCAGCCGGTCACGGTCCGCCCGTACCGATACCCGGCGGCCCACAAAGATGAGCTCGAACGCCAATGCGCCGCGATGATGGCGCAAGGCATCGTCCGCCGCAGCGACTCGGCGTT
CTCATCTCCGGTCCTCGTCAAGAAGGCGGACGGCGCATGGCGTTTCTGCGTCGACTACAGGGCGTTGAACGCGCTCACGGTCAAGGATGCGTTCCCCATCCCCGTCGTGGACGAGCTGCT
CGACGAGCTCCACGGCGCGCGTTTCTTCACCAAGCTGGACCTGCGTTCGGGGTACCACCAGGTCCGCATGCGCCCGGAGGACGTACACAAGACGGCGTTCCGCACACATGACGGACTCTA
CGAGTTCCTCGTCATGCCGTTCGGCCTCTGCAACGCGCCAGCGACATTCCAGTCCTTGATGAACGACGTCCTTCGCTGTCTAGGAGAATCCGTCCTTCTTGGTGAGGGCCGTCAACGGGG
CGGCGATGGTGCCGTAGTTGTGGACGAATTTGCGGTAGTAGCCCGCGATGCCGAGGAAGCTGCGCACCGCCGGAGCGGAGCGGGGCACCGGCCACTCGTGGATGGCCGGCACCTTGGTCG
GATCCATGGCGACGCCCGCCTCGGATATGACGTGGCCGAGGTAGGACACCGAGGCGGCGCCGAACGTGCACTTGCTGCGCTTGACGAAGAGCCGGTGAAGGCGCAGCATGGCGAGGACCG
TACGCAGGTGTCACAGGTGGTCGGCCCAAGTCGCACTGTAGATCAAAATATCATCAAAGAAGACAAGCACAAACCGACGGAGGAAGGGCCGCAGGACGTCGTTCATCAACCCCTGGAACG
TCGCCGGTGCGCTGCACAGTCCGAACGGCATGACGAGGAAGTCGTAGAGGCCGTCGTGGGTGCGGAACGTGGTCTTGTGGATGTCCTCCGGCCGCATCCGAACTTGATGGTACCCCGACA
GCTTGGTGAAGTAGCGGGTGCCATGGAGCTCGTCGAGCAGCTCATCGACGACGGGTATCGGAAAAGCGTCCTTGATGGTGAGTGCGTTGAGGGCGCGGTAATCGACACAGAAACGCCATG
AGCCGTCAGCCTTCTTGACGCGGACCGGCGAAGAAAAAGGCGAGTCGCTGCGGCGAACGACGCCCTGCTCGATCATCGCGGCGCACTGGCGTTCCAGCTCGTCTTTGTGTGCTGCTGGGT
AGCGGTACGGGCGAACAGCGACGGGGGCGGAGCCGGGTTTGAGGACGATGGCGTGATCCCAACCGCGCGGTGGAGGAAGGCTCGTGGGTTCGCCGAAGACGTCGTCATATGCGACCAGGA
GCTCGTCCAGGAGCGTCCCATTGGCCGCTGCGAGGGTGCGCAGTTGCGCTGTCGATGGCGAGGCGACGCCCGTCTAGGAGAAGTGTTGCTCGCCGCGCTGGAACGCCATCGAACGGGTGG
CGAAGTCCCACACAATGGGGCCCAGTGTGCCGAGCCACCGTGTACCGAGCACCATGTCATAACCAGCGAGGGGCATCACAAATAAGTCGGTGTGGAATGTGGTGCCGTCGATGGAGAACG
GCGCGTTCCGGATGACTCCCAGGCAGGAGACGCGCTCGCCGTTGGCGACGATAGCCGACATGCGTGGGCTGGGCTGGATCGGCAGGCCGGCACGTCGCGCCGCCTCCTCACCGATGAAGC
TGTGGGTGGAGCCGCTGTCGAGCAGTGCGAGGAGAGAGGCGGCTCCCACGGTCACCTGGAGTTGGATTGTGTCCGCGATGGGGACGCCAACGACGGCATGCAGGGAGAAAAAAGGCGCCT
CCGTATCCCCAGCAGTGTCCGCTGCGGCAGTGCCCGCATCCCCGTCCTCATCAATCTCCACGCCGTCGAGGAAGAATAGCCGGCGGCAGAACCGATTGTGGCCGTGGGTGAACTTCTCGT
TGCAGTTGAAGCACAAACCGAGACGGCGGCATTTGGCCATCTCCTCCTGGTGAGACGCCGTGGGTTGCCTTCACCGCGACCTTGCTGGGCGGCCGCTGGGGGCGCAGGGAGCGCCAGGAG
TGGCGTCGGTGCTGGTAGGGCGGCCCTGGGAGTGGCCGGTGGTGGAGCGCCGCGCTGGGGCAGGCGAGGCTGGTGCTGCGCCGGCCGGTCGTGCTCCATCAGTTCCACTTGGCGTGCAAA
GCTCATAGCGGCGGCGAGGGTTTCCGGGTGATGAATGCGGACGACATGACTCAGGGGCGGTAGGAGTCCGCCAGTGAAGTGTTGAACGCGTTGAGCCTCGTCGAGGCGTCCTGCACGCGG
TAGGAGGTCCTGGAATCGGTTGGAGTACTCCTCCACCGTGCCCGTGCGCCGGCACTCGGAGAGCTCGAAGAGCGGAGCTGAGCGGAGAGGTGGCCCGAAGCGCAGGTTCAAGAGCTCCTT
GAAGCGCCCCCACGTCGGAGCACCGTCTTCTTCCAAGAGCTGAGTGTACCAGAGTTGCGCGACGTCGTCCAGGTGATAGGACGCCATGCCGACGCGCTCCTCAGCCATGGTACGATGGTG
ACGGAAGTACGCCTCAAATTTGTTGAGGAAGAGTAGCGGATCCGTCGTGCCATCGAAACGGGGGAAGTCCCACTTCTTCGGCCGAGGGGGAAGGTCGATGTCGCGCAGGTCTTCGGAGCG
GCGGTCGTCGTTGCTGGCGGCCGACGGACGAGGCTGGTCCTTCAGGATCGCAATGTCAGCCTTCATGGCTGTCATCTCCGTGGTGAGGGTCTTGATCGAGGCCAAGACATCGGCGAGGGA
GGGTTTGCTCATGGTGTTGGGCTGGTTGACGGAGGTAGTTGGCGACGGCGGTGGGCTAGGGTTGGGCGCGGCTGCTGCGGTGGATTGGCTGGTGTTGGTGGGCGAGGATCGACGAGACTG
AGATACTAGGTTGTCAAGGGCGTAATGATCATGGGTAGCTGGCCCTCGACTACAAAGCTCGTAGTCTCCTGTCGTGTCTTCCAGTAGCGGAGGTTATGCCCCTCACGGCTGCCTGGCCTT
GAGAACGATAGGAGGAAGAAAAGGTTTTAATCTTGCTTAACCAAAAGTCTCGGTTTACAGGGAATAAAAAGGGCCATCGGCCAACTAACGGAGGAAACAAATCTAAACAGGTAACTAATA
ATATCTATCCAAATAAAACTATGTTTCTAATCTCAACCACTAGATGCAGCCGTGGCCTCCTGGACTGCGTGCGAGGAGTCCGCGCTCACCACGCTGCCCGCGGTGCCGCGCGCGCCCGCG
CGCTCTGCAGCCCGCCGGACATCCCTGGCTCGGCGTCTCCTAGTGTAGGTTTTCCCCCACATGACATAGACAACAGATGTAAAACAGGGATTAGTTACTATAGATAGCAGATGTAAATCA
AGGGAATTATCCTTGCCTTGTACAGCAAGGCCAGCCGGCCCTATATAACATAAGGCGCCCCCTCCCATTGAGGAGTTGCCAATTGCCCCCTAATCTAATTCTCTACACTTATAACCTCTA
AACATAACTTCACCTGGCATTATCAAGCTTCTGAAACCAAGGAATTCATAAACAATTTTGGTGCACCTTTTTTACCTCATTTTTTTCCAGTTTTGACTATATTTAATTTTACCTACTAAT
ACATTATGTGATATGTGATAAGCACCTTATATTGACTGTTGATTAGTAACATATGCATGAGTCCAAATAGACTTATTTGGAATCAGAGTATTTGATATCCCCTGGTTCATGGAAGGTACA
TGCCAATCAGATATAGGTGCGCACTTAAAAGTTGTTCACTTGATTTCTCAGATTGATGTGAATGGTAAGGACGCTGCACCATTGTACAAGTACTTGAAATCACAGAAAGGTGGCTTCCTT
GGCGATGGTATTAAATGGAACTTCACCAAGTTTCTTGTTGACAAAGATGGCAAGGTTGTTGAGCGATATGCTCCGACGACTTCTCCTTTGAAGATTGAG
GTTTGTTTCTCCACGTAACTG
CACATTGCGCATATTCAGCATGAGTCAATGATTTTTGCGCATATTCTGCAGAATGACATCCAGAAGCTTCTGGGCACAGCATCATGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
TGATTGAGGCTACAAGAGGGCTCAGGGGCCCCCGACTCCTCCTGTCCGTCGCCGTCCTCGTCCTCGCCATTGCTCTCGTCTTCCGCTCCCTCACCCCGGCAGTCCCGCAAATGGCCGACG
ACCTGCCCACCTCCATCTACGACATCACCGTCAAG
GATATTAGGGGTGATGACATAGAACTAAGCGAGTATGCTGGAAAGGTTCTTCTTATCGTCAATGTTGCTTCAAAATGTGGACTAA
CAAGTTCCAATTACAAAGAGCTAAATGTCTTGTATGAGAAGTACAGAGAGAAAG
GCCTTGAGATACTTGCATTCCCATGTAATCAATTTGCTGGTCAAGAGCCTGGCACCAATGAAGATA
TCCAGGAGACAGTTTGTAGCAGGTTCAAAGCAGAGTTTCCTATTTTTGACAAG
ATTGATGTGAATGGTAAGGACGCTGCACCATTGTACAAGTACTTGAAATCACAGAAAGGTGGCTTCC
TTGGCGATGGTATTAAATGGAACTTCACCAAGTTTCTTGTTGACAAAGATGGCAAGGTTGTTGAGCGATATGCTCCGACGACTTCTCCTTTGAAGATTGAG
AATGACATCCAGAAGCTTC
TGGGCACAGCATCATGA

Retrieve as FASTA