Entry information : GmPrx[P]75
Entry ID 574
Creation 2011-11-25 (Qiang Li)
Last sequence changes 2011-12-14 (Qiang Li)
Sequence status theoretical translation / pseudogene
Reviewer Not yet reviewed
Last annotation changes 2011-11-28 (Qiang Li)
Peroxidase information: GmPrx[P]75
Name GmPrx[P]75
Class Class III peroxidase    [Orthogroup: N/D] N/D
Taxonomy Eukaryota Viridiplantae Streptophyta Fabaceae Glycine
Organism Glycine max (soybean)    [TaxId: 3847 ]
Cellular localisation N/D
Tissue type Etiolated hypocotyls
Inducers Pathogen interaction
Phytophthora infection
Repressor N/D
Best BLASTp hits
Perox score E-value GmPrx[P]75
start..stop
S start..stop
GmPrx105 234 7e-79 1..135 192..332
GmPrx[P]82 227 2e-78 1..135 1..141
GmPrx[P]313 227 5e-77 1..135 108..240
GmPrx[P]219 221 2e-74 1..134 106..245
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 35674370..35674692 323 N° 2 35674715..35674796 82  
join(35674370..35674692,35674715..35674796)


exon

Literature and cross-references GmPrx[P]75
DNA ref. Phytozome 12:   Gm19 (35674370..35674796)
Other ref. Phytozome 12:   Gm19 (35674370..35674796)
Protein sequence: GmPrx[P]75
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   135
PWM (Da):   %s   15728.84  
PI (pH):   %s   8.46
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
SHTIGRPRCLSFRHKVYDAKEEYDYGYDDYKRYTSFRRILQSICHVEGRDNKFAPLDFQTPKRFDNHYFINIVEEKGLLGFDNVLINHDLHGKITEQVWAYASNEKxLMIKMGNINVLTRNEGxEIRRNCMFVNA

Retrieve as FASTA  
Remarks Pseudogene sequence from genomic. Incorrect prediction from phytozome (only the last exon have been found, contains frame shift. The first exons have not been found). No EST.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
AGCCATACTATAGGAAGACCAAGATGTCTAAGCTTCAGGCACAAGGTATATGATGCAAAAGAGGAATATGACTATGGCTATGATGACTACAAACGATACACAAGTTTCAGGAGAATCCTG
CAGTCCATATGCCATGTTGAGGGAAGGGACAATAAATTTGCACCCTTGGATTTTCAAACCCCAAAAAGATTTGACAATCACTACTTCATAAACATTGTTGAAGAGAAAGGCTTGTTAGGT
TTTGACAATGTTCTTATCAACCATGACTTACATGGAAAGATTACAGAGCAGGTGTGGGCTTATGCCTCTAATGAAAAAATNTT
GGTTGGCTTCATTTGCTAAATCTATGATTAAGATGGG
AAACATCAATGTTCTTACAAGAAATGAAGGGGNNGAAATTAGGAGGAATTGTATGTTTGTCAATGCT

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
AGCCATACTATAGGAAGACCAAGATGTCTAAGCTTCAGGCACAAGGTATATGATGCAAAAGAGGAATATGACTATGGCTATGATGACTACAAACGATACACAAGTTTCAGGAGAATCCTG
CAGTCCATATGCCATGTTGAGGGAAGGGACAATAAATTTGCACCCTTGGATTTTCAAACCCCAAAAAGATTTGACAATCACTACTTCATAAACATTGTTGAAGAGAAAGGCTTGTTAGGT
TTTGACAATGTTCTTATCAACCATGACTTACATGGAAAGATTACAGAGCAGGTGTGGGCTTATGCCTCTAATGAAAAAATNTT
TATGATTAAGATGGGAAACATCAATGTTCTTACAAGA
AATGAAGGGGNNGAAATTAGGAGGAATTGTATGTTTGTCAATGCT

Retrieve as FASTA