1. Browse the Database
  2. View Redoxidase
Entry information : GmPrx76 (Glyma17g06080.1)
Entry ID 575
Creation 2006-08-07 (Christophe Dunand)
Last sequence changes 2011-07-04 (Qiang Li)
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2015-12-16 (Christophe Dunand)
Peroxidase information: GmPrx76 (Glyma17g06080.1)
Name (synonym) GmPrx76 (Glyma17g06080.1)
Class Class III peroxidase    [Orthogroup: Prx029]
Taxonomy Eukaryota Viridiplantae Streptophyta Fabaceae Glycine
Organism Glycine max (soybean)    [TaxId: 3847 ]
Cellular localisation N/D
Tissue types Roots
Roots of 'Supernod' plants
Inducers Bradyrhizobium japonicus infection
Nodulation
Repressor N/D
Best BLASTp hits
Perox score E-value GmPrx76
start..stop		 S start..stop
GmPrx235 633 0 1..330 1..330
GmPrx288 607 0 1..330 1..332
MtPrx09 550 0 1..330 1..330
LjPrx26 543 0 10..330 13..333
Gene structure Fichier Exons►


exon

Literature and cross-references GmPrx76 (Glyma17g06080.1)
Literature Public Soybean EST Project.
DNA ref. Phytozome 12:   Gm17 (4300281..4302720)
Protein sequence: GmPrx76 (Glyma17g06080.1)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   331 (305)
PWM (Da):   %s   35750.7 (32585.2) Transmb domain:   %s   i7-24o
PI (pH):   %s   6.49 (5.35) Peptide Signal:   %s   cut: 30 range:27-331
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MKRPCSSSGYYFCLMNMFLLLLPVRSQLTTDFYKSSCPNLSKIVRREVQKALMNEIRMAASLLRLHFHDCFVNGCDGSILLDGGDDGEKSAAPNLNSARGYEVVDTIKSSVESACSGVVS
CADILAIAARDSVFLSGGPFWKVPLGRRDGTVSNGTLATEVLPAPFDPLNTIISKFTNMGLNLTDVVSLSGAHTIGRARCTLFSNRLFNFSGTGAPDSTLETGMLSDLQSLCPQNGDGNV
TTVLDRNSSDLFDIHYFKNLLSGKGLLSSDQILFSSDEANSTTKPLVQSYSNDSGQFFGDFANSMIKMGNINIKTGTDGEIRKNCRVINSQ*

Retrieve as FASTA  
Remarks Complete sequence from genomic (3 introns) and 1 EST.
DNA ►
Send to BLAST
CDS►
Send to BLAST