Entry information : NfGPx
Entry ID 5770
Creation 2007-08-24 (Christophe Dunand)
Last sequence changes 2011-11-28 (Christophe Dunand)
Sequence status complete
Reviewer Passaia Gisèle
Last annotation changes 2011-12-01 (Passaia Gisèle)
Peroxidase information: NfGPx
Name NfGPx
Class Fungi-Bacteria glutathione peroxidase    [Orthogroup: Gpx3001]
Taxonomy Eukaryota Fungi Ascomycota Eurotiomycetes Trichocomaceae Neosartorya
Organism Neosartorya fischeri    [TaxId: 36630 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value NfGPx
start..stop
S start..stop
AfumGPx 422 1.73e-152 8..233 13..232
AclGPx 358 6.98e-128 46..231 1..185
AcarGPx01 340 2.75e-119 39..240 67..267
AnGPx 331 5.89e-116 39..221 78..260
Gene structure Fichierperl './assets/cgi-bin/draw_exon.pl' '5770' 'complement(join(1..545,625..802))' Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 625..802 176 N° 2 1..545 543  
complement(join(1..545,625..802))


exon

Literature and cross-references NfGPx
Protein ref. GenPept:   EAW21338 UniProtKB:   A1D6J4
DNA ref. GenBank:   DS027690.1 (967887..967086)
Protein sequence: NfGPx
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   240
PWM (Da):   %s   26534.69  
PI (pH):   %s   9.69
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MVLSPPSITFRCSSLPYISRQSPIYRLPNTRGSLVRYPKFHLIRTMASATTFYEFKPVDKKGEPFDLASLKGKVVLVVNTASKCGFTPQFKGLENLYQSIKAKHPEDFTILGFPCNQFGS
QDPGSNDEIQSFCQVNYGVTFPVLGKLDVNGDNAAPVWTWMKETMPGLMGLKRVKWNFEKFLISADGKVVGRWASITKPESLEATILKEIEKAKKEGTAASTRKGEGEATEQATEQAKLS

Retrieve as FASTA  
Remarks Complete sequence from genomic (1 intron). strain="ATCC 1020 / DSM 3700 / NRRL 181"
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGTATTATCGCCTCCTTCCATTACATTTCGCTGTTCCTCTTTGCCATATATTTCGCGGCAAAGTCCTATATACAGACTTCCCAACACTCGAGGGTCCCTTGTGCGATATCCTAAGTTC
CATCTCATCAGGACAATGGCCTCCGCGACGACATTCTACGAGTTCAAGCCCGTCGACA
GTATGTCTCGCCTTTGCGATACCCCCTCCCAACCCCGCGAAAAAACAATGAGAATGTCTTGC
TGACCTGACCTCCACAGAGAGAAGGGCGAACCCTTCGACCTCGCCTCCCTGAAAGGCAAAGTCGTCCTCGTCGTCAACACCGCCTCCAAATGCGGCTTTACCCCTCAATTCAAAGGCCTT
GAGAACCTCTACCAGTCCATCAAGGCAAAGCACCCTGAAGACTTCACCATTCTCGGCTTCCCCTGCAACCAATTTGGCAGCCAAGACCCCGGCTCCAACGACGAGATCCAGTCCTTCTGC
CAGGTCAACTACGGCGTCACCTTCCCCGTGCTGGGCAAGTTGGATGTCAACGGCGACAATGCGGCGCCCGTGTGGACGTGGATGAAGGAGACGATGCCTGGACTTATGGGGCTGAAGCGC
GTCAAGTGGAATTTCGAGAAGTTTTTGATTTCCGCTGATGGGAAGGTCGTTGGGCGCTGGGCTAGTATTACCAAGCCTGAGTCGCTGGAAGCAACGATCCTGAAGGAGATTGAAAAGGCG
AAGAAGGAGGGGACGGCCGCTTCGACGAGGAAGGGTGAGGGAGAAGCTACCGAGCAGGCTACTGAGCAGGCTAAGTTGTCGTAG

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGTATTATCGCCTCCTTCCATTACATTTCGCTGTTCCTCTTTGCCATATATTTCGCGGCAAAGTCCTATATACAGACTTCCCAACACTCGAGGGTCCCTTGTGCGATATCCTAAGTTC
CATCTCATCAGGACAATGGCCTCCGCGACGACATTCTACGAGTTCAAGCCCGTCGACA
AGAAGGGCGAACCCTTCGACCTCGCCTCCCTGAAAGGCAAAGTCGTCCTCGTCGTCAACACC
GCCTCCAAATGCGGCTTTACCCCTCAATTCAAAGGCCTTGAGAACCTCTACCAGTCCATCAAGGCAAAGCACCCTGAAGACTTCACCATTCTCGGCTTCCCCTGCAACCAATTTGGCAGC
CAAGACCCCGGCTCCAACGACGAGATCCAGTCCTTCTGCCAGGTCAACTACGGCGTCACCTTCCCCGTGCTGGGCAAGTTGGATGTCAACGGCGACAATGCGGCGCCCGTGTGGACGTGG
ATGAAGGAGACGATGCCTGGACTTATGGGGCTGAAGCGCGTCAAGTGGAATTTCGAGAAGTTTTTGATTTCCGCTGATGGGAAGGTCGTTGGGCGCTGGGCTAGTATTACCAAGCCTGAG
TCGCTGGAAGCAACGATCCTGAAGGAGATTGAAAAGGCGAAGAAGGAGGGGACGGCCGCTTCGACGAGGAAGGGTGAGGGAGAAGCTACCGAGCAGGCTACTGAGCAGGCTAAGTTGTCG
TAG

Retrieve as FASTA