Entry information : BfuGPx
Entry ID 5779
Creation 2007-08-30 (Christophe Dunand)
Last sequence changes 2012-01-06 (Passaia Gisèle)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2012-04-23 (Catherine Mathe (Scipio))
Peroxidase information: BfuGPx
Name BfuGPx
Class Fungi-Bacteria glutathione peroxidase    [Orthogroup: Gpx3001]
Taxonomy Eukaryota Fungi Ascomycota Leotiomycetes Sclerotiniaceae Botryotinia
Organism Botryotinia fuckeliana (Botrytis cinerea Sclerotinia fuckeliana)    [TaxId: 40559 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value BfuGPx
start..stop
S start..stop
SsclGPx 333 2.08e-119 1..172 1..172
OmaiGPx01 285 2.8e-100 1..172 1..172
CfioGPx01_MH18 286 8.38e-100 1..165 74..238
CgraGPx01 285 1.84e-99 1..165 69..233
Gene structure Fichier Exons


exon

Literature and cross-references BfuGPx
Literature Birren B., et al., Annotation of the Botryotinia fuckeliana B05.10 genome.
Protein ref. GenPept:   EDN29962.1 UniProtKB:   A6RNK9
DNA ref. JGI genome:   Supercontig_1.6 (248563..247781)
Protein sequence: BfuGPx
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   172
PWM (Da):   %s   19230.71  
PI (pH):   %s   7.19
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MSSAATIYEFEPLNKKGEPTPLSEYKGKVLLIVNTASKCGFTPQYEGLEKLYKDMKEKHGDDFVILGFPCNQFGGQDPGSDEEIQSFCQINYGVSFPMKKIDVNGDNAAPLFQWLKSEKP
GLLGLQRVKWNFEKWLVGRDGKVKQRWASTTKPENLEKAVTDALNESKSEL*

Retrieve as FASTA  
Remarks Complete sequence from genomic (2 introns). 42 EST. Strain="B05.10".
DNA
Send to BLAST
CDS
Send to BLAST