Entry information : GmPrx80 (Glyma02g42730.1)
Entry ID 579
Creation 2006-08-07 (Christophe Dunand)
Last sequence changes 2011-11-28 (Qiang Li)
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2015-11-23 (Christophe Dunand)
Peroxidase information: GmPrx80 (Glyma02g42730.1)
Name (synonym) GmPrx80 (Glyma02g42730.1)
Class Class III peroxidase    [Orthogroup: Prx006]
Taxonomy Eukaryota Viridiplantae Streptophyta Fabaceae Glycine
Organism Glycine max (soybean)    [TaxId: 3847 ]
Cellular localisation N/D
Tissue types Roots
Roots of 'Supernod' plants
Inducer Flooded treatment
Repressor N/D
Best BLASTp hits
Perox score E-value GmPrx80
start..stop
S start..stop
GmPrx61 644 0 1..324 1..326
PvPrx06 571 0 1..325 1..321
GmPrx328 554 0 1..324 1..320
GmPrx158 550 0 1..325 1..321
Gene structure Fichier Exons


exon

Literature and cross-references GmPrx80 (Glyma02g42730.1)
Literature Vodkin,L. et al, A Functional Genomics Program for Soybean. Shoemaker,R et al, Public Soybean EST Project.
DNA ref. Phytozome 12:   Gm02 (47722118..47720128)
Protein sequence: GmPrx80 (Glyma02g42730.1)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   324 (298)
PWM (Da):   %s   35232.57 (32550.2)  
PI (pH):   %s   8.81 (8.94) Peptide Signal:   %s   cut: 27 range:27-324
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MASSCSSFMITLAVLVLLLGTSSANANPTLHTNFYYSSCPKLFDTVKRTVESAISKETRMGASLLRLFFHDCFVNGCDGSILLDDTSSFTGEKNAGPNRNSARGFEVIDQIKSAVEKVCP
GVVSCADILAIAARDSVEILGGPTWDVKLGRRDSRTASQSAANNDIPRPTSNLNQLISRFNALGLSTKDLVALSGGHTIGQARCTTFRARIYNETNIDSSFARMRQSRCPRTSGSGDNNL
APIDFATPRFFDNHYFKNLIQKKGLIHSDQQLFNGGSTDSIVRTYSTNPASFFADFSAAMIRMGDISPLTGSRGEIRENCRRVN*

Retrieve as FASTA  
Remarks Complete sequence from genomic (3 introns) and 5 ESTs.
DNA
Send to BLAST
CDS
Send to BLAST