Entry information : GmPrx83
Entry ID 582
Creation 2007-02-02 (Christophe Dunand)
Last sequence changes 2011-12-14 (Christophe Dunand)
Sequence status partial
Reviewer Not yet reviewed
Last annotation changes 2011-12-02 (Qiang Li)
Peroxidase information: GmPrx83
Name GmPrx83
Class Class III peroxidase    [Orthogroup: N/D] N/D
Taxonomy Eukaryota Viridiplantae Streptophyta Fabaceae Glycine
Organism Glycine max (soybean)    [TaxId: 3847 ]
Cellular localisation N/D
Tissue type Etiolated hypocotyls
Inducers Elicitor treatment (glucan, oligosaccharides, yeast extract, Phytophthora crude extract)
Wounding
Repressor N/D
Best BLASTp hits
Perox score E-value GmPrx83
start..stop
S start..stop
GmPrx134 349 6e-122 1..252 3..326
GmPrx[P]95 309 1e-106 26..246 5..295
GmPrx188 246 1e-81 5..252 3..316
MtPrx32 245 4e-81 3..252 2..340
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 5057074..5057298 225 N° 2 5056606..5056797 192 N° 3 5055957..5055977 21 N° 4 5055624..5055711 88
N° 5 5055404..5055565 162 N° 6 5050569..5050628 60  
complement(join(5050569..5050628,5055404..5055565,5055624..5055711,5055957..5055 977,5056606..5056797,5057074..5057298))


exon

Literature and cross-references GmPrx83
Literature Public Soybean EST Project.
DNA ref. Phytozome 12:   Gm03 (5057298..5050569)
Protein sequence: GmPrx83
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   252 (228)
PWM (Da):   %s   27436.01 (24810.6)  
PI (pH):   %s   8.62 (8.64) Peptide Signal:   %s   cut: 25 range:25-252
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MSATFPEFKLRICLLLCIIGTGFADSANDLRPDFYKSQCPQALEAIKAEITSAVRKEPAMGLAFFRLHFIDCVVQGCDASNLLKDTANFTGEQSAIPSLDSRNGTDIxxIEKIKARVEKLCPGVVSCADIVAFAARDSVVAGRRDSTTGYIKCLFVLAxTRIYNESNIDPSYAKAFQAFDNAYYKNLLKKKGLLHTDQELYNGGSTDSIVEFYATNPLKFIRYFVKAVIKMGNFNPFTSTNGQIRKQCSKVN

Retrieve as FASTA  
Remarks Partial sequence from genomic. No prediction from phytozome (short 3' end is missing due to "n"). No EST.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
AACTTTTCCTGAATTCAAACTCAGGATTTGTTTGCTCTTATGTATAATTGGGACAGGTTTTGCTGATTCTGCTAATGATTTACGCCCAGACTTTTATAAGTCACAATGTCCCCAAGCACT
TGAAGCCATTAAGGCAGAAATAACCTCTGCTGTGAGGAAAGAACCTGCAATGGGTTTAGCCTTCTTCCGTCTTCATTTCATTGATTGCGTTGTCCAAGCAAGTCT
TCATTTTCCTCAACT
TTTATGCCTTTATACTTATGAACAGTTTCATACAATATGCATTAATTTCTGCATGGGTTACAATATTCTTCTACGTATGAAATTAAGCTTCATAACTTACAATTTAGAGCCACATAAAAT
GTCATAGTCACACACGCACATTTATTAGATGGATGTGAGAGAAAGAAACAAAGAATATTGATCTATTAAACCGGTTTATAGAAAATTTGATCTTGATTTTTTCTGCTTTTTTTTTTGCTT
GATTATTGTGTAGGGATGTGATGCATCAAACTTGTTAAAAGACACAGCAAATTTCACGGGCGAACAAAGTGCCATTCCTAGTCTTGATTCTAGAAATGGTACGGATATCNNNNNNATAGA
GAAGATAAAAGCTAGAGTGGAGAAACTGTGCCCTGGTGTTGTCTCTTGCGCTGACATTGTAGCTTTTGCTGCGAGAGATTCCGTTGTTGCAGT
AATTAATCAATTTATATATTGGAGAAA
TAACTGTGTTTGGATTATTGCTAGTTTACAAATTAGGATTTGAATCACCTGAAATAATACTATCTATGTATGTATTTAGGGATGGAAGTAGGTCAAATTATCCATGGAAACACCTTTGGT
TTAATATGTTTAAGGATTTGAATCAACTGAAAAATAATATTATCTATGTATGTATTTAGGAATGGAAGTAGGTCAAATTATCCATGGAAACACTTTTGATTTAATATGTTTAAGATCTAG
TTTGGCTCGTTTAACTAAGGACAAACTCAAATTTTTTAAAACTTTTTTAGCAAACAAAATCCTGAATTTGAAGTTAGAAGGGACAATTTTTTCTTAAAAATAAAATATAATTTTAATTTC
TATAAAAGAATTTAATTTTTATTTTATTTTATTTTGGATTAGTCTTTTTAATTTTGAAATGTACTGTAGACTGTAGTCCTCCTCATAGCATTATTTGAGCCACTTTTCATCCCTCTAAAG
GGACATAAAAACATGTGATTTGTTTTCTGTTTCTTTTTATGTATTATACGTGACTTGCGTGATTACTGATGAATGAGACATGATTCCCAACTCGGTGGACCTAGAAAAGTGTTCGCATGG
GTCGAAGAGACTCCACAACTCAAATCTAAGTGTTGTTACAACAAATTTACGCTCTGCTTATATGGCTCTTGATGAATATCTTGCTGTATTCGGAAAAATGAATTTCACAACCAAAGAAAC
GGTTGCTTTTGTAGGTTAATTAAATTCCGTAACGCATTCTGATTGATTTTTCTATACATAATATATATATATACACACACTATCACCTGCCTCTTGCTCTTATATACACAAATTGAATGG
GTTTTTTAGGTGTTCACACTATATAGGCTACATCAAATGTCTATTTGTCCTAGCTANNACAAGGATTTATAACGAAAGCAATATAGATCCCTCGTATGCAAAAGCATTCCAAGCAAGTGT
CCCTTAGAAGGTGGAGATGACAACATAGCTCCTTTAGACATCACCACTACCATTTTGACAATGCTTATTACAAGAATTTACTGAAGAAAAAGGGTCTTTTGCACACTGATCAAGAGCTCT
ATAATGGTGGCTCAACGGACTCCATAGTTGAATTTTATGCCACGAACCCTTTAAAATTTATAAGATATTTCGTTAAGGCGGTGATTAAGATGGGA
AACNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNGAAACTTTAATCCATTTACCAGCACCAACGGGCAGATCAGAAAACAATGCAG
CAAAGTCAAT

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
AACTTTTCCTGAATTCAAACTCAGGATTTGTTTGCTCTTATGTATAATTGGGACAGGTTTTGCTGATTCTGCTAATGATTTACGCCCAGACTTTTATAAGTCACAATGTCCCCAAGCACT
TGAAGCCATTAAGGCAGAAATAACCTCTGCTGTGAGGAAAGAACCTGCAATGGGTTTAGCCTTCTTCCGTCTTCATTTCATTGATTGCGTTGTCCAAGCAAGTCT
TGCATCAAACTTGTT
AAAAGACACAGCAAATTTCACGGGCGAACAAAGTGCCATTCCTAGTCTTGATTCTAGAAATGGTACGGATATCNNNNNNATAGAGAAGATAAAAGCTAGAGTGGAGAAACTGTGCCCTGG
TGTTGTCTCTTGCGCTGACATTGTAGCTTTTGCTGCGAGAGATTCCGTTGTTGCAGT
TCGAAGAGACTCCACAACTCACTACATCAAATGTCTATTTGTCCTAGCTANNACAAGGATTTA
TAACGAAAGCAATATAGATCCCTCGTATGCAAAAGCATTCCAAGCA
TTTGACAATGCTTATTACAAGAATTTACTGAAGAAAAAGGGTCTTTTGCACACTGATCAAGAGCTCTATAATGG
TGGCTCAACGGACTCCATAGTTGAATTTTATGCCACGAACCCTTTAAAATTTATAAGATATTTCGTTAAGGCGGTGATTAAGATGGGA
AACTTTAATCCATTTACCAGCACCAACGGGCA
GATCAGAAAACAATGCAGCAAAGTCAAT

Retrieve as FASTA