1. Browse the Database
  2. View Redoxidase
Entry information : GmPrx13 (Glyma18g06230.1)
Entry ID 583
Creation 2006-06-22 (Christophe Dunand)
Last sequence changes 2011-10-12 (Qiang Li)
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2011-12-13 (Qiang Li)
Peroxidase information: GmPrx13 (Glyma18g06230.1)
Name (synonym) GmPrx13 (Glyma18g06230.1)
Class Class III peroxidase    [Orthogroup: Prx010]
Taxonomy Eukaryota Viridiplantae Streptophyta Fabaceae Glycine
Organism Glycine max (soybean)    [TaxId: 3847 ]
Cellular localisation N/D
Tissue type Roots nodules
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value GmPrx13
start..stop		 S start..stop
GmPrx70 513 0 17..322 19..325
GmPrx62 510 0 1..322 33..359
GmPrx120 507 0 1..322 1..323
GmPrx40 499 5.8e-180 1..322 1..329
Gene structure Fichier Exons►


exon

Literature and cross-references GmPrx13 (Glyma18g06230.1)
Literature Public Soybean EST Project.
DNA ref. Phytozome 12:   Gm18 (4815284..4817623)
Protein sequence: GmPrx13 (Glyma18g06230.1)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   322 (299)
PWM (Da):   %s   35034.98 (32563.6)  
PI (pH):   %s   8.73 (8.73) Peptide Signal:   %s   cut: 24 range:24-322
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MASHHLQYLVLAIATLLTISSHAQLTPDFYNNVCPQALPIIKSVV
QRAIFRERRIGASLLRLHFHDCFVNGCDGSILLDDTPNFTGEKTALPNINSIRGLEVVDEIKAAVDRACKRPVVSCADILAVAARDSVSILGGSLYWYKVLLGRRDSRTASKDAANSNLPPPFFSLSQLLSSFQSHGLDLKDLVA
LSGAHTIGFAQCATFRNRIYNDTNIDPNFASSLQGTCPRSGGDSNLAPLDRFSPSRVDTSYYTSLLSKKGLLHSDQELFKGDGGESDTLVKLYSRNPFAFARDFKASMIKMGNMKPLIGN
AGEIRVNCRSVN

Retrieve as FASTA  
Remarks Complete sequence from genomic and 4 ESTs. Cultivar="Williams".
DNA ►
Send to BLAST
CDS►
Send to BLAST