1. Browse the Database
  2. View Redoxidase
Entry information : BfuDyPrx
Entry ID 5889
Creation 2007-10-22 (Christophe Dunand)
Last sequence changes 2007-10-22 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2015-10-26 (Christophe Dunand)
Peroxidase information: BfuDyPrx
Name BfuDyPrx
Class DyP-type peroxidase D    [Orthogroup: DyPrxD001]
Taxonomy Eukaryota Fungi Ascomycota Leotiomycetes Sclerotiniaceae Botryotinia
Organism Botryotinia fuckeliana (Botrytis cinerea Sclerotinia fuckeliana)    [TaxId: 40559 ]
Cellular localisation N/D
Tissue type Mycelium
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value BfuDyPrx
start..stop		 S start..stop
SmaDyPrx 840 0 1..513 1..513
NcDyPrx 823 0 1..513 1..513
NtetDyPrx01_2509 820 0 1..513 1..513
NtetDyPrx01_2508 813 0 1..513 1..513
Gene structure Fichier Exons►


exon

Literature and cross-references BfuDyPrx
Literature Birren B., et al., Annotation of the Botryotinia fuckeliana B05.10 genome.
Protein ref. UniProtKB:   A6S1R5 [Incorrect splicing]
DNA ref. JGI genome:   Supercontig_1.34 (56578..54685)
EST ref. GenBank:   EB806132 [5' end]  EB810439 [3' end]
Protein sequence: BfuDyPrx
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   513
PWM (Da):   %s   57919.05  
PI (pH):   %s   6.39
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MSLIARKSNIQGDIWPGLPKRIQKFMFFKINKADDFKQRLRSFVKDGGITSAKDACDMKNKILAAKLQAQQSGRPAKIQSLPGVNIAFTSTGLAMGKFTFNEGAVKKDKELAKIFRKNQL
RGGLFGKGMYDDLVNEGWDDPHEIRDHYKPSPNRLIDGVFLVTAEEENHLNSMGNEIKEHFLKEQGFGDADTYLISNDPAIEFTFTREGRTRPDKGKEHFGFEDGISQPLIEGLDEVTPK
DKEPKSVKSGLIFAGHEGDDMKQPDWAEDGSFLVFRDLQQLVPEFDKWLEDNKHNAPFIGESDNPKEKLAAYLMGRWKGTPVDESPHDDKDESLFHSNNFDFHPVQEHKKCPFAAHIRKM
RPRGDLDHDHAVIIRRGISYGGEVTPEEKAVQRSDDENERGLLFVCYQSDIRNGFNFLTTRWASNHHFPDRKDNFVGEHGPGIDAIVGQRLDHHPPRSIGLPDGKKPTEARLELERWVVQ
RGGEYFFSPGIKALEGYLTDAPDYPPSLTAP

Retrieve as FASTA  
Remarks Complete sequence from genomic (6 introns) and 2 ESTs. No splicing prediction confirmed with ESTs. Strain="A1".
DNA ►
Send to BLAST
CDS►
Send to BLAST