Entry information : ZmPrx113(Zm00001d032406 / GRMZM2G068699)
Entry ID 5973
Creation 2007-11-14 (Christophe Dunand)
Last sequence changes 2011-01-25 (Christophe Dunand)
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2022-12-31 (Christophe Dunand)
Peroxidase information: ZmPrx113(Zm00001d032406 / GRMZM2G068699)
Name ZmPrx113(Zm00001d032406 / GRMZM2G068699)
Class Class III peroxidase    [Orthogroup: Prx062]
Taxonomy Eukaryota Viridiplantae Streptophyta Monocotyledons Poaceae Zea
Organism Zea mays    [TaxId: 4577 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value ZmPrx113
start..stop
S start..stop
SbPrx05 512 0 57..356 32..338
SiPrx167 482 1.1e-172 54..356 26..333
CescPrx29 338 5.54e-116 55..356 22..326
SpolPrx28 334 2.25e-114 41..355 9..326
Gene structure Fichierperl './assets/cgi-bin/draw_exon.pl' '5973' 'complement(join(222299825..222300598,222300701..222300997))' Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 222300701..222300997 295 N° 2 222299825..222300598 772  
complement(join(222299825..222300598,222300701..222300997))


exon

Literature and cross-references ZmPrx113(Zm00001d032406 / GRMZM2G068699)
DNA ref. GenBank:   AC177835.2 (152616..153695)
Protein sequence: ZmPrx113(Zm00001d032406 / GRMZM2G068699)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   356
PWM (Da):   %s   38163.83 Transmb domain:   %s   i40-59o
PI (pH):   %s   10.64
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MRAHPIPRTNVHRSPHGHRPAITIVSRHQTMALLPPRRSLLLLLALAVHAAAAVQLHFYARSCPRAEAIVRRAVRRRAAHDRSVLPALIRLHFHDCFVRGCDGSVLIDSTPGHPAEKDAP
PNLTLRMLDVIDDAKAAVERTCPGVVSCADIVALAARDAAAMAGKVRYEVPTGRRDGTVSSAAEVSLPGPSASFADAMSAFRSAGLGVVDLTALLGSHTMGFCHCGLIMGRLYGYNRTCE
SDPAMDPGLLAALRRRCPPPQNESRDAVVPMNFVAPLGPFGLDNALYPSVLAGRAVLQIDQELASSGVARRIAAMFATLPGSFRRQFAKSMVRLGNVNVLTGRQGEVRLNCRRFNS*

Retrieve as FASTA  
Remarks Complete sequence from genomic (chromo 1, intron 1). No EST. Same contig than ZmPrx92. Uncorrect prediction from Phytozome (PS is missing)
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGCGCGCTCATCCGATCCCGAGAACGAACGTACATCGATCTCCCCACGGCCACCGACCGGCCATCACCATCGTCAGTCGTCACCAGACCATGGCCCTGCTGCCGCCGCGTCGTTCCCTG
CTGCTTCTGTTGGCGCTCGCGGTGCACGCCGCCGCGGCCGTGCAGCTGCACTTCTACGCGCGGTCGTGCCCCCGCGCCGAGGCCATCGTCCGGCGCGCCGTCCGCCGCCGCGCCGCGCAC
GACCGCTCCGTGCTCCCCGCGCTCATCCGCCTGCATTTCCACGACTGCTTCGTCAGG
GTACGTATGTTGGACTGCTGCACGCTCCCACATTTTCGTCGCCTCGGTCTGATTCTGATAATC
TGATGCCGTGTGTGCATGGTTCCGTGCACCACCCACCAGGGGGATGCGATGGCTCCGTGCTCATCGACAGCACGCCCGGCCACCCCGCCGAGAAGGATGCCCCGCCGAACCTGACGCTGC
GGATGCTGGACGTGATCGACGACGCCAAGGCGGCGGTCGAGAGGACCTGCCCGGGCGTCGTGTCGTGCGCCGACATCGTGGCGCTGGCCGCCAGGGACGCCGCGGCGATGGCGGGGAAGG
TGCGGTACGAGGTGCCCACGGGGAGGAGGGACGGCACCGTGTCCAGCGCCGCCGAGGTGAGCCTGCCTGGCCCCTCCGCGTCGTTCGCCGACGCCATGTCGGCCTTCCGCTCCGCCGGCC
TCGGCGTGGTGGACCTCACCGCCCTGCTCGGCTCTCACACCATGGGGTTCTGCCACTGCGGGCTCATCATGGGCAGGCTCTACGGCTACAACCGCACCTGCGAGTCCGACCCGGCCATGG
ACCCCGGCCTGCTGGCCGCGCTCCGGCGCCGGTGCCCGCCGCCGCAGAACGAGTCGCGCGACGCGGTCGTGCCCATGAACTTCGTCGCGCCGCTCGGCCCGTTCGGCCTCGACAACGCCC
TGTACCCGAGCGTGCTCGCGGGGAGAGCCGTGCTGCAGATCGACCAGGAGCTCGCGTCCTCCGGCGTCGCCCGCAGGATCGCGGCAATGTTCGCCACGCTGCCGGGGAGCTTCCGGAGGC
AGTTCGCGAAGTCGATGGTGAGGCTGGGGAACGTCAACGTTCTCACGGGGAGGCAAGGGGAAGTCAGGCTCAACTGCCGAAGGTTTAACAGCTGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGCGCGCTCATCCGATCCCGAGAACGAACGTACATCGATCTCCCCACGGCCACCGACCGGCCATCACCATCGTCAGTCGTCACCAGACCATGGCCCTGCTGCCGCCGCGTCGTTCCCTG
CTGCTTCTGTTGGCGCTCGCGGTGCACGCCGCCGCGGCCGTGCAGCTGCACTTCTACGCGCGGTCGTGCCCCCGCGCCGAGGCCATCGTCCGGCGCGCCGTCCGCCGCCGCGCCGCGCAC
GACCGCTCCGTGCTCCCCGCGCTCATCCGCCTGCATTTCCACGACTGCTTCGTCAGG
GGATGCGATGGCTCCGTGCTCATCGACAGCACGCCCGGCCACCCCGCCGAGAAGGATGCCCCG
CCGAACCTGACGCTGCGGATGCTGGACGTGATCGACGACGCCAAGGCGGCGGTCGAGAGGACCTGCCCGGGCGTCGTGTCGTGCGCCGACATCGTGGCGCTGGCCGCCAGGGACGCCGCG
GCGATGGCGGGGAAGGTGCGGTACGAGGTGCCCACGGGGAGGAGGGACGGCACCGTGTCCAGCGCCGCCGAGGTGAGCCTGCCTGGCCCCTCCGCGTCGTTCGCCGACGCCATGTCGGCC
TTCCGCTCCGCCGGCCTCGGCGTGGTGGACCTCACCGCCCTGCTCGGCTCTCACACCATGGGGTTCTGCCACTGCGGGCTCATCATGGGCAGGCTCTACGGCTACAACCGCACCTGCGAG
TCCGACCCGGCCATGGACCCCGGCCTGCTGGCCGCGCTCCGGCGCCGGTGCCCGCCGCCGCAGAACGAGTCGCGCGACGCGGTCGTGCCCATGAACTTCGTCGCGCCGCTCGGCCCGTTC
GGCCTCGACAACGCCCTGTACCCGAGCGTGCTCGCGGGGAGAGCCGTGCTGCAGATCGACCAGGAGCTCGCGTCCTCCGGCGTCGCCCGCAGGATCGCGGCAATGTTCGCCACGCTGCCG
GGGAGCTTCCGGAGGCAGTTCGCGAAGTCGATGGTGAGGCTGGGGAACGTCAACGTTCTCACGGGGAGGCAAGGGGAAGTCAGGCTCAACTGCCGAAGGTTTAACAGCTGA

Retrieve as FASTA