Entry information : MePrx11 (cassava4.1_024093m)
Entry ID 6065
Creation 2007-12-18 (Christophe Dunand)
Last sequence changes 2011-12-01 (Qiang Li)
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2016-01-06 (Christophe Dunand)
Peroxidase information: MePrx11 (cassava4.1_024093m)
Name (synonym) MePrx11 (cassava4.1_024093m)
Class Class III peroxidase    [Orthogroup: Prx011]
Taxonomy Eukaryota Viridiplantae Streptophyta Euphorbiaceae Manihot
Organism Manihot esculenta (cassava)    [TaxId: 3983 ]
Cellular localisation N/D
Tissue type Stems
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value MePrx11
start..stop
S start..stop
MePrx60 585 0 1..329 1..329
RcPrx21 563 0 3..329 7..334
EglPrx134 556 0 1..329 1..329
EgrPrx134 556 0 1..329 1..329
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 424379..424594 216 N° 2 424076..424276 201 N° 3 423821..423986 166 N° 4 423048..423451 404
complement(join(423048..423451,423821..423986,424076..424276,424379..424594))


exon

Literature and cross-references MePrx11 (cassava4.1_024093m)
Literature Lopez,C., Jorge,V., Piegu,B., Mba,C., Cortes,D., Restrepo,S., Soto ,M., Laudie,M., Berger,C., Cooke,R., Delseny,M., Tohme,J. and Verdier,V. A unigene catalogue of 5700 expressed genes in cassava. Plant Mol. Biol. 56 (4), 541-554 (2004).
DNA ref. Phytozome 12:   scaffold10878 (424594..423048)
EST ref. GenBank:   CK645574.1 [Fragment]
Protein sequence: MePrx11 (cassava4.1_024093m)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   329
PWM (Da):   %s   35896.12  
PI (pH):   %s   9.14
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MGRFQLILLLPLSFSLCFFSSSVSAQLRQNYYANICPNVESIVRNAVQKKFQQTFVTIPGTLRLFFHDCFVQGCDASVIIQSTPNNKAEKDHPDNLSLAGDGFDTVIKAKAAVDAIPSCRNKVSCADILAMATRDVVALSGGPSYAVELGRLDGLRSSAANVNGNLPKESFNLNQLNSLFASRGLSQADMIALSAAHTLGFSHCNKFSNRIYNFSRQNPVDPTLNKAYAADLQQMCPRNVDPRIAINMDPITPNTFDNVYFKNLQNGKGLFTSDQVLFTDPRSRPTVNTWASNSQAFENAFVTAMTKLGRVGVKTGRNGNIRRDCAVL

Retrieve as FASTA  
Remarks Complete sequence from genomic (3 introns) and 1 EST.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGGTCGTTTCCAGCTTATTCTTCTACTGCCACTCTCTTTCAGTTTGTGCTTTTTTTCTAGTTCTGTGTCAGCTCAGCTCAGACAAAATTATTACGCCAATATTTGCCCGAATGTGGAA
TCTATTGTTAGAAATGCAGTTCAAAAGAAATTTCAGCAGACTTTTGTCACTATCCCTGGAACCCTCCGTCTCTTCTTCCATGATTGCTTTGTGCAG
GTAGCCATTTATTTCCTTCAGAAA
ATTAAGAAGAAAAAAAAAAAACCATGACTCCATTTTAGCTTGCTTAATTTGTTTCTGTTTACATATGTATATATAAAGGGATGTGATGCTTCTGTTATAATCCAATCTACTCCGAACAAC
AAAGCAGAGAAAGACCACCCTGATAATTTGTCATTGGCCGGAGATGGATTTGACACGGTCATCAAGGCCAAAGCCGCCGTGGATGCCATTCCCAGCTGCAGAAACAAGGTGTCGTGTGCA
GATATTCTTGCCATGGCAACTAGAGATGTGGTGGCTCTG
GTGAGTCCACAGTCCTTGTGTAATTTCTACCTGAAATTTCATTGTCGTAATTCATTTATTCTGTATACGTGAATGTGATGT
AAATGCAGTCTGGTGGACCCTCATATGCTGTTGAATTGGGAAGATTGGATGGCCTCAGATCTAGTGCTGCTAACGTTAATGGCAATCTGCCTAAGGAAAGTTTCAATCTGAATCAGCTCA
ACTCTCTCTTTGCTTCTCGTGGCCTCTCCCAAGCTGACATGATTGCCCTCTCAG
GTTCAAAAATTTCATATACTCTACCNNNNNNNNNNNNNNNNNNNNNNNNNNNNCTAGTCCGATCCA
TAATTTTTTATTTAAGGCATAATAAATAAGGNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNGTATGAATAAGGCAAAGTGGATTTTTTTTTTG
GGTAAAATTATAAAGGGAACATCTGTAGATTCTCGTCCCGTTTGACAGGTCAATTTTGTTTTGGACTTTATTTACTTTAATATAGTCCTATGACCTGGCATTGGTTGTTAACTACTCAGC
AAATTGAAAAGTCAAAGTTTTGATTCAGTGATGCTAATCACCATTAATCTGATTTTTCTACAGCTGCACACACCCTTGGATTCTCCCACTGCAATAAATTCAGCAACAGGATATACAATT
TCAGCCGTCAAAATCCAGTGGACCCTACACTCAACAAGGCTTATGCAGCTGATTTACAGCAGATGTGCCCCAGGAACGTGGACCCCAGGATAGCCATTAACATGGACCCGATCACACCGA
ACACCTTCGACAACGTGTACTTCAAGAACCTCCAGAATGGAAAGGGACTCTTCACTTCGGACCAAGTTCTCTTCACGGACCCAAGGTCCAGGCCCACTGTTAATACATGGGCCAGCAACT
CCCAAGCCTTTGAAAACGCCTTTGTTACCGCCATGACGAAGTTGGGCCGGGTCGGAGTCAAGACGGGTAGAAATGGAAATATTCGTCGAGACTGTGCCGTTTTAAAT

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGGTCGTTTCCAGCTTATTCTTCTACTGCCACTCTCTTTCAGTTTGTGCTTTTTTTCTAGTTCTGTGTCAGCTCAGCTCAGACAAAATTATTACGCCAATATTTGCCCGAATGTGGAA
TCTATTGTTAGAAATGCAGTTCAAAAGAAATTTCAGCAGACTTTTGTCACTATCCCTGGAACCCTCCGTCTCTTCTTCCATGATTGCTTTGTGCAG
GGATGTGATGCTTCTGTTATAATC
CAATCTACTCCGAACAACAAAGCAGAGAAAGACCACCCTGATAATTTGTCATTGGCCGGAGATGGATTTGACACGGTCATCAAGGCCAAAGCCGCCGTGGATGCCATTCCCAGCTGCAGA
AACAAGGTGTCGTGTGCAGATATTCTTGCCATGGCAACTAGAGATGTGGTGGCTCTG
TCTGGTGGACCCTCATATGCTGTTGAATTGGGAAGATTGGATGGCCTCAGATCTAGTGCTGCT
AACGTTAATGGCAATCTGCCTAAGGAAAGTTTCAATCTGAATCAGCTCAACTCTCTCTTTGCTTCTCGTGGCCTCTCCCAAGCTGACATGATTGCCCTCTCAG
CTGCACACACCCTTGGA
TTCTCCCACTGCAATAAATTCAGCAACAGGATATACAATTTCAGCCGTCAAAATCCAGTGGACCCTACACTCAACAAGGCTTATGCAGCTGATTTACAGCAGATGTGCCCCAGGAACGTG
GACCCCAGGATAGCCATTAACATGGACCCGATCACACCGAACACCTTCGACAACGTGTACTTCAAGAACCTCCAGAATGGAAAGGGACTCTTCACTTCGGACCAAGTTCTCTTCACGGAC
CCAAGGTCCAGGCCCACTGTTAATACATGGGCCAGCAACTCCCAAGCCTTTGAAAACGCCTTTGTTACCGCCATGACGAAGTTGGGCCGGGTCGGAGTCAAGACGGGTAGAAATGGAAAT
ATTCGTCGAGACTGTGCCGTTTTAAAT

Retrieve as FASTA