Entry information : SmPrx05-1_110 (SmPrx05a_110)
Entry ID 6197
Creation 2008-06-26 (Christophe Dunand)
Last sequence changes 2008-06-26 (Christophe Dunand)
Sequence status complete
Reviewer Qiang Li
Last annotation changes 2011-09-04 (Qiang Li)
Peroxidase information: SmPrx05-1_110 (SmPrx05a_110)
Name (synonym) SmPrx05-1_110 (SmPrx05a_110)
Class Class III peroxidase    [Orthogroup: Prx053]
Taxonomy Eukaryota Viridiplantae Streptophyta Isoetopsida Selaginellaceae Selaginella
Organism Selaginella moellendorffii    [TaxId: 88036 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value SmPrx05-1_110
start..stop
S start..stop
SmPrx05-2_11 671 0 1..336 1..336
SmPrx06-2_11 605 0 18..336 20..339
SmPrx06-1_110 595 0 18..336 20..339
SmPrx27-1_10 407 3.13e-143 9..335 13..331
Gene structure Fichierperl './assets/cgi-bin/draw_exon.pl' '6197' 'complement(join(417596..418041,418097..418259,418318..418515,418580..418783))' Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 418580..418783 202 N° 2 418318..418515 196 N° 3 418097..418259 161 N° 4 417596..418041 444
complement(join(417596..418041,418097..418259,418318..418515,418580..418783))


exon

Literature and cross-references SmPrx05-1_110 (SmPrx05a_110)
DNA ref. Phytozome 12:   scaffold_110 (418783..417596)
mRNA ref. JGI transcript:   236097
EST ref. GenBank:   FE463882.1 [5' end]  FE475730.1 [3' end]
Protein sequence: SmPrx05-1_110 (SmPrx05a_110)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   336 (318)
PWM (Da):   %s   36071.97 (34224.0)  
PI (pH):   %s   7.66 (7.70) Peptide Signal:   %s   cut: 19 range:19-336
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MASMQLLCLGLLVAAVFSASAPDSLHSYARSCPSAEQIVAATVKS
AADRDPTAPAGIIRLFFHDCFVQ
GCDGSILLESTPTAGRDVEMFALGNNNSARGFEIIEAAKTRLEAVCPGVVSCADVLAFAARDATTYFGGMFYTVPTGRLDGRISSRTEANSLPGPASSFSRLRDIFRGKGLSVHDLVLLSGGHTIGRAKCRFVETRVYNFNNTGRPDPSLDATYREELRRICPQGANPSPTVALDRNSEFSFDNAYYRNLEANRGLLSSDAVLRTDPDAANLINSLAQNPPTFRSMFAQSMINMGNIEWK
TRANGEIRKKCSAVNSRITTEVGDVASF

Retrieve as FASTA  
Remarks Complete sequence from genomic (3 introns) and 3 ESTs. Tandem with SmPrx06a.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTTCAATGCAACTTCTCTGCCTTGGACTCCTCGTAGCAGCAGTTTTTTCTGCGTCTGCTCCCGATTCTCTTCACAGCTATGCTCGATCTTGTCCGAGCGCTGAACAGATAGTCGCG
GCCACTGTCAAGAGTGCAGCTGACCGGGATCCAACAGCACCAGCCGGGATTATCCGCTTGTTCTTCCATGACTGCTTTGTCCAG
GTAAGTTCATCGTCTTAGCAGCTTTATGTATGTGAG
TTGTGACGAATGTGACTCATTTGTCCAGGGGGGTGCGATGGATCGATACTTTTGGAATCCACTCCTACTGCTGGCAGAGATGTGGAGATGTTCGCGCTCGGGAACAACAACTCTGCTCGT
GGTTTCGAGATTATCGAGGCCGCAAAAACTCGCCTGGAGGCTGTGTGCCCGGGAGTTGTGAGCTGTGCGGATGTGCTTGCGTTTGCTGCCAGGGACGCGACAACCTAC
GTAAGCACAAGT
CGGCTTTTGTTGATTTCTCTTTGACTTTGCCGGCAAATTTATGTAGTTTTTGGAGGGATGTTCTACACTGTGCCTACGGGTCGCCTTGACGGACGAATCTCTAGCAGAACAGAAGCCAAC
AGCTTACCGGGTCCCGCTTCCTCGTTCAGTCGGCTGAGAGACATCTTCAGGGGCAAAGGCTTGTCAGTTCATGACCTCGTGCTGCTCTCCG
GTAAGAAGCTTCTCTTGAAGCTAGAACTC
TCCACCCACTAACATTGCAATAACAGGCGCGGACACACCATTGGTCGCGCGAAGTGTAGATTCGTCGAGACTCGTGTCTACAACTTTAACAACACCGGACGTCCCGACCCAAGCCTGGAC
GCTACGTACCGCGAGGAGCTCCGGCGTATTTGCCCGCAGGGAGCAAACCCGAGCCCGACGGTGGCGCTAGACAGGAACTCGGAGTTTAGCTTCGACAACGCTTACTACAGGAACCTCGAG
GCCAACAGGGGGCTGCTTTCGTCGGACGCGGTGCTCCGGACCGACCCGGACGCTGCCAATCTCATCAACTCGCTCGCTCAGAACCCGCCAACGTTCCGCTCCATGTTCGCGCAGTCGATG
ATCAACATGGGAAACATCGAGTGGAAGACGAGAGCCAACGGGGAGATAAGGAAGAAGTGCTCGGCCGTGAACTCCAGGATCACCACCGAAGTGGGCGACGTTGCGTCCTTCTAG

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTTCAATGCAACTTCTCTGCCTTGGACTCCTCGTAGCAGCAGTTTTTTCTGCGTCTGCTCCCGATTCTCTTCACAGCTATGCTCGATCTTGTCCGAGCGCTGAACAGATAGTCGCG
GCCACTGTCAAGAGTGCAGCTGACCGGGATCCAACAGCACCAGCCGGGATTATCCGCTTGTTCTTCCATGACTGCTTTGTCCAG
GGGTGCGATGGATCGATACTTTTGGAATCCACTCCT
ACTGCTGGCAGAGATGTGGAGATGTTCGCGCTCGGGAACAACAACTCTGCTCGTGGTTTCGAGATTATCGAGGCCGCAAAAACTCGCCTGGAGGCTGTGTGCCCGGGAGTTGTGAGCTGT
GCGGATGTGCTTGCGTTTGCTGCCAGGGACGCGACAACCTAC
TTTGGAGGGATGTTCTACACTGTGCCTACGGGTCGCCTTGACGGACGAATCTCTAGCAGAACAGAAGCCAACAGCTTA
CCGGGTCCCGCTTCCTCGTTCAGTCGGCTGAGAGACATCTTCAGGGGCAAAGGCTTGTCAGTTCATGACCTCGTGCTGCTCTCCG
GCGGACACACCATTGGTCGCGCGAAGTGTAGATTC
GTCGAGACTCGTGTCTACAACTTTAACAACACCGGACGTCCCGACCCAAGCCTGGACGCTACGTACCGCGAGGAGCTCCGGCGTATTTGCCCGCAGGGAGCAAACCCGAGCCCGACGGTG
GCGCTAGACAGGAACTCGGAGTTTAGCTTCGACAACGCTTACTACAGGAACCTCGAGGCCAACAGGGGGCTGCTTTCGTCGGACGCGGTGCTCCGGACCGACCCGGACGCTGCCAATCTC
ATCAACTCGCTCGCTCAGAACCCGCCAACGTTCCGCTCCATGTTCGCGCAGTCGATGATCAACATGGGAAACATCGAGTGGAAGACGAGAGCCAACGGGGAGATAAGGAAGAAGTGCTCG
GCCGTGAACTCCAGGATCACCACCGAAGTGGGCGACGTTGCGTCCTTCTAG

Retrieve as FASTA