Entry information : SmPrx04-2_114 (SmPrx04b_114)
Entry ID 6198
Creation 2008-06-26 (Christophe Dunand)
Last sequence changes 2011-01-25 (Toky Ramarohetra (Scipio))
Sequence status complete
Reviewer Paula Nunes
Last annotation changes 2011-01-25 (Toky Ramarohetra (Scipio))
Peroxidase information: SmPrx04-2_114 (SmPrx04b_114)
Name (synonym) SmPrx04-2_114 (SmPrx04b_114)
Class Class III peroxidase    [Orthogroup: Prx025]
Taxonomy Eukaryota Viridiplantae Streptophyta Isoetopsida Selaginellaceae Selaginella
Organism Selaginella moellendorffii    [TaxId: 88036 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value SmPrx04-2_114
start..stop
S start..stop
SmPrx04-1_122 664 0 1..323 1..323
CmichPrx14 376 2.87e-131 21..320 40..339
SmPrx80-1_13 372 7.92e-130 20..322 25..325
PabPrx64 371 1.47e-129 7..320 8..327
Gene structure Fichierperl './assets/cgi-bin/draw_exon.pl' '6198' 'join(301534..301737,301794..302154,302212..302618)' Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 301534..301737 202 N° 2 301794..302154 359 N° 3 302212..302618 405  
join(301534..301737,301794..302154,302212..302618)


exon

Literature and cross-references SmPrx04-2_114 (SmPrx04b_114)
Literature JGI sequencing project
DNA ref. Phytozome 12:   scaffold_114 (301534..302618)
mRNA ref. JGI transcript:   132875
Protein sequence: SmPrx04-2_114 (SmPrx04b_114)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   323 (302)
PWM (Da):   %s   35092.7 (32884.5)  
PI (pH):   %s   7.11 (7.13) Peptide Signal:   %s   cut: 22 range:22-323
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MVSSGLCFSLTVLLLLMLVTSELTVDYYKRTCPHAESILRQVMVQ
KIREAPTTAGATLRLLFHDCFVD
GCDASVLVSSTPGNKAERDEEINHSLAGDAFDAVHRAKAAVEKICPGVVSCADVLAIITRDLVQLVGGPFWEVRKGRKDGRLSMASRVGRNLPTSTASINELTRLFASKGLNEIDLIALSGAHTIGFAHCTEFTNRIYNFNGTRAGDPSMNPSFLGELRRACPPRNGNPDVVASMDAATPFQFDNSYYRSMQRGLGLLTSDQELLTNARTRSVVDAFASSQDLFYEVFAASMDKLGNVGV
KNETNGVVRKECHRT

Retrieve as FASTA  
Remarks Complete sequence from genomic (introns 1 and 3). No EST.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGTTTCATCTGGCCTGTGTTTCAGCTTAACCGTGTTACTTCTGCTCATGCTTGTAACTTCAGAGCTGACAGTGGACTACTACAAGCGGACTTGCCCGCATGCCGAGAGCATTCTCAGA
CAGGTGATGGTTCAAAAGATAAGGGAAGCACCAACAACAGCTGGAGCAACACTGCGACTCCTTTTTCATGACTGCTTCGTTGAC
ACGTGAGTTGTCCTTTCTCCTGAGGTTCTTGAGTTT
TCTTATTTGTTTTTGAGGCCAGGGATGTGATGCTTCGGTCCTCGTTTCGTCAACTCCTGGCAACAAGGCTGAAAGAGACGAGGAGATAAATCATTCATTAGCGGGAGATGCCTTTGATGC
AGTTCATCGAGCTAAAGCAGCAGTGGAAAAGATTTGTCCCGGTGTGGTCTCTTGCGCTGATGTTCTGGCTATCATCACGAGGGATTTGGTTCAGCTAGTTGGCGGTCCTTTCTGGGAAGT
CAGGAAAGGCCGTAAAGACGGAAGGTTGTCTATGGCTTCCCGGGTCGGCCGCAATCTCCCGACTTCCACAGCATCTATCAACGAATTAACCAGGCTGTTCGCTTCCAAGGGCCTCAATGA
AATCGATCTGATAGCGCTCTCTG
TGGTAAGCACTCTCTCAGTGCTTTTTAAGCTGCTCGCTAATCCCTCGTTCTTCTTCCAGGTGCTCATACAATCGGCTTTGCACACTGCACGGAATTC
ACGAACAGGATCTACAACTTTAACGGCACCAGAGCCGGCGATCCAAGCATGAATCCGAGCTTCCTCGGCGAACTACGACGAGCTTGTCCTCCGCGAAATGGAAATCCCGATGTGGTAGCA
AGCATGGACGCAGCAACACCCTTCCAGTTCGACAACTCCTACTACCGGAGCATGCAGAGAGGTCTGGGCCTTCTCACCTCCGACCAGGAGCTCCTTACAAACGCAAGAACTCGCAGCGTC
GTGGACGCATTTGCCAGCAGCCAGGATCTCTTCTACGAAGTCTTTGCGGCTTCCATGGACAAGCTGGGAAACGTCGGTGTGAAGAACGAGACGAACGGGGTGGTAAGAAAAGAGTGCCAC
AGAACTTGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGTTTCATCTGGCCTGTGTTTCAGCTTAACCGTGTTACTTCTGCTCATGCTTGTAACTTCAGAGCTGACAGTGGACTACTACAAGCGGACTTGCCCGCATGCCGAGAGCATTCTCAGA
CAGGTGATGGTTCAAAAGATAAGGGAAGCACCAACAACAGCTGGAGCAACACTGCGACTCCTTTTTCATGACTGCTTCGTTGAC
GGATGTGATGCTTCGGTCCTCGTTTCGTCAACTCCT
GGCAACAAGGCTGAAAGAGACGAGGAGATAAATCATTCATTAGCGGGAGATGCCTTTGATGCAGTTCATCGAGCTAAAGCAGCAGTGGAAAAGATTTGTCCCGGTGTGGTCTCTTGCGCT
GATGTTCTGGCTATCATCACGAGGGATTTGGTTCAGCTAGTTGGCGGTCCTTTCTGGGAAGTCAGGAAAGGCCGTAAAGACGGAAGGTTGTCTATGGCTTCCCGGGTCGGCCGCAATCTC
CCGACTTCCACAGCATCTATCAACGAATTAACCAGGCTGTTCGCTTCCAAGGGCCTCAATGAAATCGATCTGATAGCGCTCTCTG
GTGCTCATACAATCGGCTTTGCACACTGCACGGAA
TTCACGAACAGGATCTACAACTTTAACGGCACCAGAGCCGGCGATCCAAGCATGAATCCGAGCTTCCTCGGCGAACTACGACGAGCTTGTCCTCCGCGAAATGGAAATCCCGATGTGGTA
GCAAGCATGGACGCAGCAACACCCTTCCAGTTCGACAACTCCTACTACCGGAGCATGCAGAGAGGTCTGGGCCTTCTCACCTCCGACCAGGAGCTCCTTACAAACGCAAGAACTCGCAGC
GTCGTGGACGCATTTGCCAGCAGCCAGGATCTCTTCTACGAAGTCTTTGCGGCTTCCATGGACAAGCTGGGAAACGTCGGTGTGAAGAACGAGACGAACGGGGTGGTAAGAAAAGAGTGC
CACAGAACTTGA

Retrieve as FASTA