Entry information : SmPrx08-1_40 (SmPrx08a_40)
Entry ID 6202
Creation 2008-06-30 (Christophe Dunand)
Last sequence changes 2008-06-30 (Christophe Dunand)
Sequence status complete
Reviewer Paula Nunes
Last annotation changes 2011-01-25 (Toky Ramarohetra (Scipio))
Peroxidase information: SmPrx08-1_40 (SmPrx08a_40)
Name (synonym) SmPrx08-1_40 (SmPrx08a_40)
Class Class III peroxidase    [Orthogroup: Prx076]
Taxonomy Eukaryota Viridiplantae Streptophyta Isoetopsida Selaginellaceae Selaginella
Organism Selaginella moellendorffii    [TaxId: 88036 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value SmPrx08-1_40
start..stop
S start..stop
SmPrx08-2_107 659 0 1..328 1..326
CmichPrx06 403 8e-142 6..328 7..329
GbPrx24 394 3e-138 27..328 28..328
ApuncPrx04 395 4e-138 29..328 70..371
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 1685419..1685643 225 N° 2 1685142..1685330 189 N° 3 1684708..1684873 166 N° 4 1683823..1684229 407
complement(join(1683823..1684229,1684708..1684873,1685142..1685330,1685419..1685 643))


exon

Literature and cross-references SmPrx08-1_40 (SmPrx08a_40)
Literature JGI
DNA ref. Phytozome 12:   scaffold_40 (1685643..1683823)
mRNA ref. JGI transcript:   233332
Protein sequence: SmPrx08-1_40 (SmPrx08a_40)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   328 (301)
PWM (Da):   %s   35369 (32570.4)  
PI (pH):   %s   8 (7.72) Peptide Signal:   %s   cut: 28 range:28-328
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MLSIGAALAKIWLVIALGASIWPASHQQQLDSNFYRSRCPALEPISATAVARQIRKDPTSAAPLVRMFFHDCFVQGCDASVLLDSTKNSTAEKEATPNVSLRQFDVLEEIKTQVEAKCPGVVSCADIVALAARDATVQTGGPSWNVEFGRRDGRSSSDAMAAAHLPSSRSSAQPLIDSFAAVGLSIRDLVTLSGAHTFGRAHCTQVARRFYAFNNASGIDPTLDSSYAQRLRRLCPQPLDAHGMVDLDPITPNVFDTLYYQGLLMNLGIFSSDSALVLDNRTKVFVQEYAVNPVSFVQQFPGAMVRLGRIGVLTGSQGEIRKRCNVVN

Retrieve as FASTA  
Remarks Complete sequence from genomic (3 introns). Contig also contains SmPrx07a. No EST.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGCTATCGATCGGAGCGGCATTGGCGAAGATTTGGCTGGTAATCGCGCTGGGAGCGTCGATCTGGCCAGCGTCCCATCAGCAGCAGCTGGATTCCAATTTCTATCGCTCGCGATGCCCC
GCGCTGGAGCCGATCTCCGCCACGGCCGTGGCGCGGCAGATTAGGAAGGATCCGACCTCCGCCGCGCCGCTCGTCCGGATGTTCTTCCACGATTGCTTCGTCCAG
GCAAGGCGCACTCGT
ATTTCGATCGATCGATCGGCGAAATATTTTGGTCTGACATGTTTTGCGCGTGTTCTTGTTTCTTTCTTGACAGGGTTGCGATGCGTCAGTGCTACTAGATTCGACCAAGAACAGCACGGC
CGAGAAGGAGGCAACGCCAAACGTATCGCTGCGCCAATTCGATGTCCTGGAGGAGATCAAGACGCAGGTGGAGGCCAAATGTCCGGGAGTGGTTTCTTGCGCCGACATTGTGGCGCTGGC
CGCTAGAGATGCCACAGTCCAG
GTACGCGAATCGATTCTAGCTCATCGATCGAAATTCGCGAAGATTTCCCTCTTCTTGTTCTTGGTTCTCTTTCTCTCTCTTGCTCACGCTCGGGAAAA
GGGAAAGGATGATTCCGTCGTGCTTCTCGTGATGCCAGCCAAATTCATCTCTCACGCGCTCGATTTCTTGGAAAGATCGTTCCATTCCTTGCCTGCATTGATTGATTGTCATGAGCATCG
GCATCGCAGCTTTAAAAATTCACTCTTCTTCCTCGTTTGCTCCTTGGCAGACTGGAGGACCGAGCTGGAACGTGGAATTCGGGCGGAGGGATGGGCGGAGCTCGTCCGACGCGATGGCTG
CCGCGCATTTACCATCGTCGCGATCCAGCGCCCAGCCTCTCATCGACAGCTTCGCGGCGGTGGGGCTGTCAATCCGGGATCTGGTGACTCTATCAG
GTACTCTGTTCTTCCCCTGGCTCG
TGATGTCATACTCCATGTCATAGCCCTGGCTTTTTCCCTGGGTTTTGGTTCCCGTTATGTCATAGTCCCTGGTTTTGGTCTCCGAACATGTCATAACCCCCCAGGTTCTAGTCCACGTGT
TCTTAAAGTTGCTGTGCCCGAATCCTTTGTCCTGTCTCCTTCACTGCAATGCCTGACTGAATTCTCGCTGTCACTAGTTACCACTGTCATCCACTGGAAGACATTGGAGAGTTCTGTCTG
AGGTAAATGTTTGTTTCTTATCCCTTCGCCACTCATTGTTCTACTCGATTTGACTGGCATTTGTTCTGGAGCTCTGGAGCTCTGCGTAGCGTAGGATCTTCTTTGGACTAGACAATCCAA
GTTGCGTGACTTGATCGACTTGATCGATCGATCGAACGCGCTCCTGGAATGGTTTTTTATTCTCGTCCTTTCTCATACTTTCTCTCTTTTGCAGGAGCTCATACTTTTGGACGAGCGCAC
TGCACCCAAGTGGCGCGTCGCTTCTATGCTTTCAACAACGCCAGCGGCATCGATCCCACGCTCGACTCCAGCTACGCGCAGCGGCTCCGGCGGCTGTGCCCGCAGCCGTTGGATGCCCAC
GGAATGGTCGACCTGGATCCAATCACGCCCAACGTCTTCGACACGCTCTACTACCAGGGACTGCTCATGAACCTGGGGATATTCTCCTCCGATTCCGCGCTCGTTCTGGACAACCGGACG
AAGGTGTTCGTGCAGGAATATGCGGTCAACCCAGTCTCGTTCGTTCAACAGTTTCCGGGCGCCATGGTCAGACTTGGTCGCATTGGTGTGTTGACCGGCAGTCAAGGTGAGATTAGAAAA
AGATGTAACGTGGTCAACTGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGCTATCGATCGGAGCGGCATTGGCGAAGATTTGGCTGGTAATCGCGCTGGGAGCGTCGATCTGGCCAGCGTCCCATCAGCAGCAGCTGGATTCCAATTTCTATCGCTCGCGATGCCCC
GCGCTGGAGCCGATCTCCGCCACGGCCGTGGCGCGGCAGATTAGGAAGGATCCGACCTCCGCCGCGCCGCTCGTCCGGATGTTCTTCCACGATTGCTTCGTCCAG
GGTTGCGATGCGTCA
GTGCTACTAGATTCGACCAAGAACAGCACGGCCGAGAAGGAGGCAACGCCAAACGTATCGCTGCGCCAATTCGATGTCCTGGAGGAGATCAAGACGCAGGTGGAGGCCAAATGTCCGGGA
GTGGTTTCTTGCGCCGACATTGTGGCGCTGGCCGCTAGAGATGCCACAGTCCAG
ACTGGAGGACCGAGCTGGAACGTGGAATTCGGGCGGAGGGATGGGCGGAGCTCGTCCGACGCGATG
GCTGCCGCGCATTTACCATCGTCGCGATCCAGCGCCCAGCCTCTCATCGACAGCTTCGCGGCGGTGGGGCTGTCAATCCGGGATCTGGTGACTCTATCAG
GAGCTCATACTTTTGGACGA
GCGCACTGCACCCAAGTGGCGCGTCGCTTCTATGCTTTCAACAACGCCAGCGGCATCGATCCCACGCTCGACTCCAGCTACGCGCAGCGGCTCCGGCGGCTGTGCCCGCAGCCGTTGGAT
GCCCACGGAATGGTCGACCTGGATCCAATCACGCCCAACGTCTTCGACACGCTCTACTACCAGGGACTGCTCATGAACCTGGGGATATTCTCCTCCGATTCCGCGCTCGTTCTGGACAAC
CGGACGAAGGTGTTCGTGCAGGAATATGCGGTCAACCCAGTCTCGTTCGTTCAACAGTTTCCGGGCGCCATGGTCAGACTTGGTCGCATTGGTGTGTTGACCGGCAGTCAAGGTGAGATT
AGAAAAAGATGTAACGTGGTCAACTGA

Retrieve as FASTA