Entry information : CrePrxII0501 (PRX5 / CrePrxIIE01)
Entry ID 6209
Creation 2008-07-04 (Christophe Dunand)
Last sequence changes 2011-08-16 (Qiang Li)
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2011-08-16 (Christophe Dunand)
Peroxidase information: CrePrxII0501 (PRX5 / CrePrxIIE01)
Name (synonym) CrePrxII0501 (PRX5 / CrePrxIIE01)
Class Atypical 2-Cysteine peroxiredoxin (type II)    [Orthogroup: PrxII001]
Taxonomy Eukaryota Viridiplantae Chlorophyta Chlorophyceae Chlamydomonadaceae Chlamydomonas
Organism Chlamydomonas reinhardtii    [TaxId: 3055 ]
Cellular localisation N/D
Tissue type N/D
Inducer Carbon treatment
Repressor N/D
Best BLASTp hits
Perox score E-value CrePrxII0501
start..stop
S start..stop
PtaPrxII05 244 4.59e-83 21..193 66..239
PabPrxII178 241 7.87e-82 21..193 66..239
HaPrxII04 238 7.64e-81 31..193 49..213
PpaPrxII0501 235 4.23e-79 24..193 72..243
Gene structure Fichier Exons


exon

Literature and cross-references CrePrxII0501 (PRX5 / CrePrxIIE01)
Literature Chlamydomonas Annotation Team; JGI Annotation Team. The Chlamydomonas genome reveals the evolution of key animal and plant functions. Science 318 (5848), 245-250 (2007)
DNA ref. GenBank:   DS496108 (570296..572738)
mRNA ref. GenBank:   XM_001689403
Cluster/Prediction ref. UniGene:   Cre.2393
Protein sequence: CrePrxII0501 (PRX5 / CrePrxIIE01)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   194
PWM (Da):   %s   20861.78 Transmb domain:   %s   i7-29o
PI (pH):   %s   8.84
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MLANIFQQTRLAGRQMQRAAVRSSHGRVQVVTRAIAVGQKLPEGKFKYFDGEGQMRDVTTDELCKGKKVVLFAVPGAFTPTCSLKHVPGFVDKADEFKTGVDTIACVSVNDAFVMAAWGK
DLKAGDKVLMLADGNGQFTKALGVELDLVDKGLGLRSRRYSMYVEDGVVK
VLHLEEGGAFTVSSAEDMLGSLP*

Retrieve as FASTA  
Remarks Complete sequence from genomic (4 introns) and 35 ESTs. Strain="CC-503 cw92 mt+".
DNA
Send to BLAST
CDS
Send to BLAST
cDNA
Send to BLAST