Entry information : CrePrxII0501 (PRX5 / CrePrxIIE01)
Entry ID 6209
Creation 2008-07-04 (Christophe Dunand)
Last sequence changes 2011-08-16 (Qiang Li)
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2011-08-16 (Christophe Dunand)
Peroxidase information: CrePrxII0501 (PRX5 / CrePrxIIE01)
Name (synonym) CrePrxII0501 (PRX5 / CrePrxIIE01)
Class Atypical 2-Cysteine peroxiredoxin (type II)    [Orthogroup: PrxII001]
Taxonomy Eukaryota Viridiplantae Chlorophyta Chlorophyceae Chlamydomonadaceae Chlamydomonas
Organism Chlamydomonas reinhardtii    [TaxId: 3055 ]
Cellular localisation N/D
Tissue type N/D
Inducer Carbon treatment
Repressor N/D
Best BLASTp hits
Perox score E-value CrePrxII0501
start..stop
S start..stop
PtaPrxII05 244 4e-83 21..193 66..239
PabPrxII178 241 7e-82 21..193 66..239
HaPrxII04 238 7e-81 31..193 49..213
PpaPrxII0501 235 4e-79 24..193 72..243
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 106..134 29 N° 2 610..720 111 N° 3 855..1014 160 N° 4 1337..1549 213
N° 5 1853..1924 72  
join(106..134,610..720,855..1014,1337..1549,1853..1924)


exon

Literature and cross-references CrePrxII0501 (PRX5 / CrePrxIIE01)
Literature Chlamydomonas Annotation Team; JGI Annotation Team. The Chlamydomonas genome reveals the evolution of key animal and plant functions. Science 318 (5848), 245-250 (2007)
DNA ref. GenBank:   DS496108 (570296..572738)
mRNA ref. GenBank:   XM_001689403
Cluster/Prediction ref. UniGene:   Cre.2393
Protein sequence: CrePrxII0501 (PRX5 / CrePrxIIE01)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   194
PWM (Da):   %s   20861.78  
PI (pH):   %s   8.84
Sequence 235
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MLANIFQQTRLAGRQMQRAAVRSSHGRVQVVTRAIAVGQKLPEGKFKYFDGEGQMRDVTTDELCKGKKVVLFAVPGAFTPTCSLKHVPGFVDKADEFKTKGVDTIACVSVNDAFVMAAWGKDLKAGDKVLMLADGNGQFTKALGVELDLVDKGLGLRSRRYSMYVEDGVVKVLHLEEGGAFTVSSAEDMLGSLP

Retrieve as FASTA  
Remarks Complete sequence from genomic (4 introns) and 35 ESTs. Strain="CC-503 cw92 mt+".
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
TGCTCGCCAACATCTTCCAGCAGACCCGGTAGGTCCACTAGTGTTGAAAGTGAACGCGGGCTAGGGACGGTGGCTCGCCCGATGCCAAGCAATCAGCCCTGAATCAGTTTGCAGCGGCAC
CGAGGCAAGGGCTTGTTGCATGCAGCTGCTCAACTTGGCGTATATCGCTCGTAGTTCGTGGCGCTGTCCTGACAGCATCGTCGCTCGTGTCGACCGGGTGTTGCTGGTTCGCGGGTCGGG
CCGGGTTGCTCAGCCACTGTCTCAGCGACCCGACAATCCCACACTAGACATCGGAAGTCTCAGCGTTGGTGTTTGGGCAATGGTTGGGGTTGGCCCATTGGCCTTGGAAACGTTGCGTCT
GCTTGCACTCCCGCCCCGCCCCCGCCGACGCGCCTCTGCACAAGCCCGTAACTTCTGTGACCGGCGCAATGCGCTTATACGCATGCACGCTGTGTATAACTCTGCACCTGAGGTCCCTTG
CGCTGGGCTGTCCGGGGCTGCAGGCTCGCTGGGCGGCAAATGCAGCGCGCGGCCGTCCGGTCCAGCCACGGCCGTGTGCAGGTGGTGACCCGGGCCATCGCCGTGGGCCAGAAGCTGCCA
GAGGGGAAGTTTAA
GTGAGTCCGACACATAATGACCATCTGCAACTGCACCTGAACTGGATGGCGCAGGGATGCTGGCAGGGGCCTGTATCCCCTCCTTCGGGCCCGGCAGGTGCATGGC
TTAAACCCGTTGCCACGTTGGGATGCAGGTACTTTGATGGCGAGGGCCAGATGCGCGATGTGACCACGGACGAGCTCTGTAAAGGCAAGAAGGTTGTGCTGTTCGCGGTACCGGGCGCCT
TCACGCCCACCTGCTCGCTGAAGCACGTGCCGGGCTTCGTGGACAAGGCGGATGAGTTCAAGACCAAG
GTACGAGATGGGGTGCAGAGCAGCGTTGGAAGCAAGGACGGAAATGCAAGGC
GGCATATGTGGAGGGTCAAGCTGATGCAACTTCGGGAGGCACCGTGACTCGTCAGGTCTCGGGCCAGTTGCTCAACCGCGCCGCCCCGTACCACGTTCCTCTGCTTTCGCCGACACTACG
TTCTGCTGCGTTTCCCAGCCTGTCTTCTCGGTGTTGTCCGGCGTGTGCAAAGGTCTCCATTACGCTGCAACTGAGCTATCCTGCGACTTGGCTACAACCCCCAGCCCCCCAATTTCCCCA
ACCTCCCCGGCATCATCCTGCCTCCTGCAGGGCGTGGACACGATTGCGTGCGTGTCCGTAAACGACGCGTTCGTGATGGCGGCGTGGGGCAAGGACCTGAAGGCGGGCGACAAGGTGCTC
ATGCTGGCTGACGGCAACGGCCAGTTCACCAAGGCGCTGGGCGTGGAGCTGGACCTGGTGGACAAGGGGCTGGGGCTGCGCTCGCGCCGCTACTCCATGTACGTGGAGGACGGCGTGGTC
AAG
GTGAGGAGGGAAGGAGGTGGTGGCCGGGTGCGGAGGTTGTAGGGGTGGGACTGGGCAGGCTTAGGCAGCAAAATCACAGTCGTGGGCGCGTGCAAAGGGCAGTTGCCACGAGTGCGG
CATGCACGCGAGGCGATGGCAATTCTGGACTGCTGCTTGACGGCTGTGAGGAACAAGGCAGGCTTTTGCTGAGCCGGCACGTACGTGTCATCATCATTTTCCGGCGGGGTGGCCACGCGG
GTCCCTTCTTCGTCGATTTACCACATGCATCAGCATCACGGCTTGCGTCTGCCTCCCTGTCCACAGGTGCTTCACCTGGAGGAGGGCGGCGCGTTTACCGTGTCATCCGCTGAGGACATG
CTGGGCAGCCTTCCGTGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
TGCTCGCCAACATCTTCCAGCAGACCCGGCTCGCTGGGCGGCAAATGCAGCGCGCGGCCGTCCGGTCCAGCCACGGCCGTGTGCAGGTGGTGACCCGGGCCATCGCCGTGGGCCAGAAGC
TGCCAGAGGGGAAGTTTAA
GTACTTTGATGGCGAGGGCCAGATGCGCGATGTGACCACGGACGAGCTCTGTAAAGGCAAGAAGGTTGTGCTGTTCGCGGTACCGGGCGCCTTCACGCCCA
CCTGCTCGCTGAAGCACGTGCCGGGCTTCGTGGACAAGGCGGATGAGTTCAAGACCAAG
GGCGTGGACACGATTGCGTGCGTGTCCGTAAACGACGCGTTCGTGATGGCGGCGTGGGGCA
AGGACCTGAAGGCGGGCGACAAGGTGCTCATGCTGGCTGACGGCAACGGCCAGTTCACCAAGGCGCTGGGCGTGGAGCTGGACCTGGTGGACAAGGGGCTGGGGCTGCGCTCGCGCCGCT
ACTCCATGTACGTGGAGGACGGCGTGGTCAAG
GTGCTTCACCTGGAGGAGGGCGGCGCGTTTACCGTGTCATCCGCTGAGGACATGCTGGGCAGCCTTCCGTGA

Retrieve as FASTA  
cDNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
AATAAACATC ACTAAGTTTC GAGAACAGTC AAGACTTCAT TTTAGATTAC GCACAGGCAG CCCTATTGCA AGCCATCGGC GTTGGTATCA GCAAAATCAG CAATAATGCT CGCCAACATC  TTCCAGCAGA CCCGGCTCGC TGGGCGGCAA ATGCAGCGCG CGGCCGTCCG GTCCAGCCAC GGCCGTGTGC AGGTGGTGAC CCGGGCCATC GCCGTGGGCC AGAAGCTGCC AGAGGGGAAG  TTTAAGTACT TTGATGGCGA GGGCCAGATG CGCGATGTGA CCACGGACGA GCTCTGTAAA GGCAAGAAGG TTGTGCTGTT CGCGGTACCG GGCGCCTTCA CGCCCACCTG CTCGCTGAAG  CACGTGCCGG GCTTCGTGGA CAAGGCGGAT GAGTTCAAGA CCAAGGGCGT GGACACGATT GCGTGCGTGT CCGTAAACGA CGCGTTCGTG ATGGCGGCGT GGGGCAAGGA CCTGAAGGCG  GGCGACAAGG TGCTCATGCT GGCTGACGGC AACGGCCAGT TCACCAAGGC GCTGGGCGTG GAGCTGGACC TGGTGGACAA GGGGCTGGGG CTGCGCTCGC GCCGCTACTC CATGTACGTG  GAGGACGGCG TGGTCAAGGT GCTTCACCTG GAGGAGGGCG GCGCGTTTAC CGTGTCATCC GCTGAGGACA TGCTGGGCAG CCTTCCGTGA GCTGCCGACC CGCTGAGCGA TCTAGGCCGA  GGTCGGCCGC GCGGAGGCGA GTTGGGCCAA GCAGGGACGG GCGTTCAGGA GCTTATGATA CACTAGCTGT GCTGGACGGG ACAAGGCTCA ATGCACCGGT AGTTGAGAGC CAAGGCGCAT  ACACGGAGGG AGCATGGGCC GCAGATAATG GCGAGAGGAC TGCGGTTCGG GGTGCGGCAC AGAGAGGATG CTGGCCTCCG TTGTGAAGGG TAACCCAGAA CGCGGCCCAT GTCATGTGTT  GATGATGGTC AAACGGCGGC AAATGAACAG TTTGAGGCGG CAGACGGTGT ACAGTCAGTG ATATAGCATG GGCTAGCCGT TGTCGTGGGT TGTTGTCTGC GTGTCTGTGG GGGGTAAGAA  GGCTATTGGA CGTTAGTGCT TGCATTTTCA GCGGCGGCGC ATTCTAGTAA TAGGTGTATT CGCATCCCGT CGCATTCTTC GGGGATGATC GGCATCAGTT TGCAGGGATG TAATGCCAAT 
TGTTCGCCC 

Retrieve as FASTA