Entry information : Sm2CysPrx02-1_34 (Sm2CysPrx02a_34)
Entry ID 6218
Creation 2008-07-07 (Christophe Dunand)
Last sequence changes 2010-05-31 (Christophe Dunand)
Sequence status theoretical translation / pseudogene
Reviewer Not yet reviewed
Last annotation changes 2011-01-25 (Toky Ramarohetra (Scipio))
Peroxidase information: Sm2CysPrx02-1_34 (Sm2CysPrx02a_34)
Name (synonym) Sm2CysPrx02-1_34 (Sm2CysPrx02a_34)
Class Typical 2-Cysteine peroxiredoxin     [Orthogroup: 2CysPrx001]*
Taxonomy Eukaryota Viridiplantae Streptophyta Isoetopsida Selaginellaceae Selaginella
Organism Selaginella moellendorffii    [TaxId: 88036 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value Sm2CysPrx02-1_34
start..stop
S start..stop
Sm2CysPrx02-2_18 572 0 1..291 1..286
Spol2CysPrx01 326 2.9e-113 68..291 23..251
Nt2CysPrx01-1A 323 1.06e-111 102..291 78..271
Zm2CysPrx01 321 2.33e-111 100..291 65..260
Gene structure Fichierperl './assets/cgi-bin/draw_exon.pl' '6218' 'join(502763..503026,503056..503160,503216..503297,503355..503434,503494..503619,503721..503834,503885..503989)' Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 502763..503026 262 N° 2 503056..503160 103 N° 3 503216..503297 80 N° 4 503355..503434 78
N° 5 503494..503619 124 N° 6 503721..503834 112 N° 7 503885..503989 103  
join(502763..503026,503056..503160,503216..503297,503355..503434,503494..503619, 503721..503834,503885..503989)


exon

Literature and cross-references Sm2CysPrx02-1_34 (Sm2CysPrx02a_34)
Literature JGI
DNA ref. Phytozome 12:   scaffold_34 (502763..503989)
Protein sequence: Sm2CysPrx02-1_34 (Sm2CysPrx02a_34)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   291 (112)
PWM (Da):   %s   32192.91 (12554.6)  
PI (pH):   %s   9.13 (4.77) Peptide Signal:   %s   cut: 19 range:16-127
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MALGLGVQAFSPRGAISIASTSLVEEKRGSAIPERQCERVAFARR
ISPHELLQLCSSRERENAVGVRFRRRKRNVIAAGAPAPPPPSQ
TIDFNLHKYQIDRPLVGSMAPNFEAEAVHHQEFIKVKLSNYIGKKFVVLFFYPLNFTFVCPTELTAFSDRYGEFQKLDTEVLAVSSDSFSHLAWIQTDRKSGGLGELNYPVVSDLTKAIT
KAYRVLLPDQ
GISLRGLFIIDKEGIVQHATINNLAVGRNVDEALRLVQAVQYVKVHPDELCPAGWQPGEHGIKPDPKHFAAV*

Retrieve as FASTA  
Remarks Complete sequence from genomic (6 introns). No EST.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCGCTAGGGTTAGGGGTTCAAGCGTTCTCCCCGCGCGGGGCGATCTCGATTGCTTCTACGTCGCTGGTGGAGGAGAAGCGAGGATCAGCGATTCCGGAGCGCCAGTGCGAGCGCGTA
GCATTCGCGAGAAGAATCTCTCCGCATGAACTTTTGCAGCTATGCTCGTCAAGAGAAAGAGAGAATGCCGTGGGAGTGAGGTTTAGAAGGAGAAAGAGAAATGTGATTGCCGCGGGAGCG
CCAGCGCCTCCACCTCCATCGCAG
AGGTATGGTTGAATTATTTTTATTTTTCCAGACTATAGATTTTAACTTGCATAAGTATCAGATAGATCGGCCTTTGGTGGGTAGCATGGCACCAAA
CTTTGAAGCCGAGGCTGTCCATCACCAAGAGTTTATCAAG
AGGTACAAAACTGTCTACATGTTTTCCAAAAATTCGTTTGAAGTTTTTTCTTGGCAGGTCAAGCTTTCCAATTACATTGG
AAAGAAGTTCGTCGTTCTTTTCTTCTACCCCCTCAATTTCACCTTCGTCTGCCCGACAG
AGGTATCTAGCTTTTTCTTTGAAACTTTGTTTCATTCTCTGCGTGTGTGTTTTCAACAGAG
CTAACAGCGTTCAGCGATCGGTATGGTGAGTTTCAAAAGCTCGACACTGAGGTGCTCGCAGTATCATCCGACAGTGTA
TAGTAAGCTCAAAATCCATTTTTCCTTGTCACTGGTTCTGTC
CTTGACATTTTCCTTCCAGTTCTCTCACCTAGCGTGGATCCAAACTGACCGGAAGTCTGGGGGACTTGGGGAACTCAATTACCCAGTTGTTTCGGATCTGACCAAGGCAATCACCAAAGC
CTATCGCGTGTTGCTACCCGACCAG
AGGTCTTTCTATTCACTCGCCGATCACACTCATAGAACATAAGAGGCAAGGCAAAAACACATTTTTAAGTCTCTCGCAACTAACCTTTGCATAAA
AACCACAGGGTATTTCCTTGAGAGGATTGTTTATAATCGACAAGGAAGGCATCGTTCAGCATGCTACAATCAACAATCTTGCTGTTGGGCGCAACGTTGACGAGGCCCTCAGGCTTGTCC
AG
AGGTAACTTCACTCGTTTATATGTTTCATGTCGACAAAATCGTTTCTTTCAGGCTGTCCAATACGTGAAAGTGCATCCGGACGAGCTATGTCCAGCGGGCTGGCAGCCTGGGGAGCAC
GGGATTAAACCAGATCCAAAGCACTTTGCTGCTGTCTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCGCTAGGGTTAGGGGTTCAAGCGTTCTCCCCGCGCGGGGCGATCTCGATTGCTTCTACGTCGCTGGTGGAGGAGAAGCGAGGATCAGCGATTCCGGAGCGCCAGTGCGAGCGCGTA
GCATTCGCGAGAAGAATCTCTCCGCATGAACTTTTGCAGCTATGCTCGTCAAGAGAAAGAGAGAATGCCGTGGGAGTGAGGTTTAGAAGGAGAAAGAGAAATGTGATTGCCGCGGGAGCG
CCAGCGCCTCCACCTCCATCGCAG
ACTATAGATTTTAACTTGCATAAGTATCAGATAGATCGGCCTTTGGTGGGTAGCATGGCACCAAACTTTGAAGCCGAGGCTGTCCATCACCAAGAG
TTTATCAAG
GTCAAGCTTTCCAATTACATTGGAAAGAAGTTCGTCGTTCTTTTCTTCTACCCCCTCAATTTCACCTTCGTCTGCCCGACAGAGCTAACAGCGTTCAGCGATCGGTATGGT
GAGTTTCAAAAGCTCGACACTGAGGTGCTCGCAGTATCATCCGACAGTGTA
TTCTCTCACCTAGCGTGGATCCAAACTGACCGGAAGTCTGGGGGACTTGGGGAACTCAATTACCCAGTT
GTTTCGGATCTGACCAAGGCAATCACCAAAGCCTATCGCGTGTTGCTACCCGACCAG
GGTATTTCCTTGAGAGGATTGTTTATAATCGACAAGGAAGGCATCGTTCAGCATGCTACAATC
AACAATCTTGCTGTTGGGCGCAACGTTGACGAGGCCCTCAGGCTTGTCCAG
GCTGTCCAATACGTGAAAGTGCATCCGGACGAGCTATGTCCAGCGGGCTGGCAGCCTGGGGAGCACGGG
ATTAAACCAGATCCAAAGCACTTTGCTGCTGTCTAA

Retrieve as FASTA  
cDNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCGCTAG GGTTAGGGGT TCAAGCGTTC TCCCCGCGCG GGGCGATCTC GATTGCTTCT ACGTCGCTGG TGGAGGAGAA GCGAGGATCA GCGATTCCGG AGCGCCAGTG CGAGCGCGTA  GCATTCGCGA GAAGAATCTC TCCGCATGAA CTTTTGCAGC TATGCTCGTC AAGAGAAAGA GAGAATGCCG TGGGAGTGAG GTTTAGAAGG AGAAAGAGAA ATGTGATTGC CGCGGGAGCG  CCAGCGCCTC CACCTCCATC GCAGACTATA GATTTTAACT TGCATAAGTA TCAGATAGAT CGGCCTTTGG TGGGTAGCAT GGCACCAAAC TTTGAAGCCG AGGCTGTCCA TCACCAAGAG  TTTATCAAGG TCAAGCTTTC CAATTACATT GGAAAGAAGT TCGTCGTTCT TTTCTTCTAC CCCCTCAATT TCACCTTCGT CTGCCCGACA GAGCTAACAG CGTTCAGCGA TCGGTATGGT  GAGTTTCAAA AGCTCGACAC TGAGGTGCTC GCAGTATCAT CCGACAGTGT ATTCTCTCAC CTAGCGTGGA TCCAAACTGA CCGGAAGTCT GGGGGACTTG GGGAACTCAA TTACCCAGTT  GTTTCGGATC TGACCAAGGC AATCACCAAA GCCTATCGCG TGTTGCTACC CGACCAGGGT ATTTCCTTGA GAGGATTGTT TATAATCGAC AAGGAAGGCA TCGTTCAGCA TGCTACAATC  AACAATCTTG CTGTTGGGCG CAACGTTGAC GAGGCCCTCA GGCTTGTCCA GGCTGTCCAA TACGTGAAAG TGCATCCGGA CGAGCTATGT CCAGCGGGCT GGCAGCCTGG GGAGCACGGG 
ATTAAACCAG ATCCAAAGCA CTTTGCTGCT GTCTAA 

Retrieve as FASTA