Entry information : SmPrxQ-1_21 (SmPrxQa_21)
Entry ID 6219
Creation 2008-07-07 (Christophe Dunand)
Last sequence changes 2012-04-26 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2012-04-26 (Christophe Dunand)
Peroxidase information: SmPrxQ-1_21 (SmPrxQa_21)
Name (synonym) SmPrxQ-1_21 (SmPrxQa_21)
Class Atypical 2-Cysteine peroxiredoxin (type Q)    [Orthogroup: PrxQ001]
Taxonomy Eukaryota Viridiplantae Streptophyta Isoetopsida Selaginellaceae Selaginella
Organism Selaginella moellendorffii    [TaxId: 88036 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value SmPrxQ-1_21
start..stop
S start..stop
SmPrxQ-2_31 444 1e-161 1..220 1..220
PabPrxQ23 277 1e-95 59..220 58..219
PabPrxQ22 272 8e-94 63..220 63..219
GbPrxQ01 268 5e-92 63..220 66..222
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 1420112..1420327 216 N° 2 1420444..1420581 138 N° 3 1420631..1420720 90 N° 4 1421247..1421465 219
join(1420112..1420327,1420444..1420581,1420631..1420720,1421247..1421465)


exon

Literature and cross-references SmPrxQ-1_21 (SmPrxQa_21)
Literature Richardson,P., Lucas,S., Rokhsar,D., Wang,M. and Lindquist,E.A. DOE Joint Genome Institute Selaginella moellendorffii EST project. Unpublished (2008).
DNA ref. Phytozome 12:   scaffold_21 (1420112..1421465)
mRNA ref. Phytozome 12:   148953 [Incorrect prediction]
EST ref. GenBank:   FE446757.1
Cluster/Prediction ref. UniGene:   Smo.828
Protein sequence: SmPrxQ-1_21 (SmPrxQa_21)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   220
PWM (Da):   %s   23609.23  
PI (pH):   %s   9.93
Sequence 261
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MASSSAAPLCGGAVLAAAAPRKSPALSSCAAILRPPCLASSSIAAESSLFRRVCGLGVAKSPSRRLLSTSCKLSQGDVLPSFNLKDQEGRVVNSSKFKNKPVVLYFYPADESPGCTKEACAFRDSYDKFRKAGAEVIGISADTPESHKAFAKKYRLPFTLLTDEGNKLRKDWGIPGDFFGSLPGRQTYVIDKKGVVRLVFNNQFQPEKHAMETLKVLESM

Retrieve as FASTA  
Remarks Complete sequence from genomic (3 introns) and 32 ESTs. Unigene compiles ESTs from both haplotypes. incorrect prediction from Phytozome (first exon is missing)
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
TGGCTTCTTCGTCAGCGGCTCCGCTCTGTGGAGGAGCAGTGCTCGCCGCCGCTGCGCCTCGCAAATCCCCGGCATTGTCCTCCTGCGCAGCGATTCTCCGGCCCCCATGCCTCGCCAGCT
CGTCAATCGCCGCGGAATCCAGCTTGTTTCGCAGGGTTTGCGGCCTGGGAGTCGCGAAATCGCCGTCCAGGAGGCTTCTTTCCACGAGCTGCAAG
GTAAGATGCCCGCATTGCGAGGATT
TTCCCAAAAAAATTGCGAGTGCCAATCTTGGGATGGATGGATTCCTGAGAAGATTCATAGTGTAGGGCTCTGAGCAAGGGATTACGTGCAGCTGAGCCAGGGCGATGTTCTCCCCTCGTT
CAATCTCAAGGACCAGGAGGGGCGAGTGGTGAATTCATCCAAGTTTAAGAACAAGCCCGTGGTCTTGTACTTCTATCCGGCCGATGAGTCGCCAGGATGCACCAAAGAG
GTAGAAAAAAA
ATTAAAATCCTTGCCTTGTCTAATCTCTGATCGATCAGGCTTGCGCGTTTCGGGATTCTTACGATAAATTCAGGAAGGCTGGAGCGGAAGTGATTGGCATCAGTGCCGATACTCCAGAGT
CTCACAAG
GTACATTGCTTGATTCCCAGCTTCTTTCGTCTTCCAAGGTCTTAGAGATCTTAGAATTTGGACTGCTGGATTGGTTTTGTGTGAGAGTTTTTACGAGCTTTTCGAAGTGGTC
ACTGTGTGCTCGAAAGTTTCAAGATTGGATTGTGGTATACTTGGTTTTGAGAGAGCAACTTTGCTCGAAGCTTTTAGCTTTTGTGCTCGATAGTTTGAGATCTACCAAATTGGATTGTGG
TATACTTGGTTTTGTGTTTCCATACTTAGTGTTCACTCAAGTTTGTTGATAGTTTCTGGCCAGCCGATCGAAGCTTTTAGTTTTTGTGCTCAAAAGTTTCAGAGATCTTCCAGTTTTGCG
AGTTCCGTTGAGTCATTTGCTAAGAATTTTGTTCCCTAGAGATTGGATTGTGTTTCCAATCTTGGTGAGAGTATTTATGAGTTCTCTGATAGTTTCTGCCCAGCCGATCGAAGTATTTAG
CTTTAGTGCTCCAAAGTTTCAGAGTTCTAACGTTGGATCTTTCGCTATTCGTAGGCATTCGCGAAGAAATACCGGCTTCCATTCACGCTGCTCACCGACGAAGGAAACAAGCTAAGAAAG
GACTGGGGAATCCCCGGCGACTTCTTTGGCTCGCTGCCGGGAAGGCAAACTTACGTGATCGACAAAAAGGGTGTTGTGCGGCTCGTCTTCAACAACCAGTTCCAGCCCGAGAAGCACGCC
ATGGAGACGCTCAAGGTTCTCGAAAGCATGTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
TGGCTTCTTCGTCAGCGGCTCCGCTCTGTGGAGGAGCAGTGCTCGCCGCCGCTGCGCCTCGCAAATCCCCGGCATTGTCCTCCTGCGCAGCGATTCTCCGGCCCCCATGCCTCGCCAGCT
CGTCAATCGCCGCGGAATCCAGCTTGTTTCGCAGGGTTTGCGGCCTGGGAGTCGCGAAATCGCCGTCCAGGAGGCTTCTTTCCACGAGCTGCAAG
CTGAGCCAGGGCGATGTTCTCCCCT
CGTTCAATCTCAAGGACCAGGAGGGGCGAGTGGTGAATTCATCCAAGTTTAAGAACAAGCCCGTGGTCTTGTACTTCTATCCGGCCGATGAGTCGCCAGGATGCACCAAAGAG
GCTTGCG
CGTTTCGGGATTCTTACGATAAATTCAGGAAGGCTGGAGCGGAAGTGATTGGCATCAGTGCCGATACTCCAGAGTCTCACAAG
GCATTCGCGAAGAAATACCGGCTTCCATTCACGCTGC
TCACCGACGAAGGAAACAAGCTAAGAAAGGACTGGGGAATCCCCGGCGACTTCTTTGGCTCGCTGCCGGGAAGGCAAACTTACGTGATCGACAAAAAGGGTGTTGTGCGGCTCGTCTTCA
ACAACCAGTTCCAGCCCGAGAAGCACGCCATGGAGACGCTCAAGGTTCTCGAAAGCATGTAA

Retrieve as FASTA  
cDNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
GAAAGCAAAG AAGCCCAAAA CCATGGCTTC TTCGTCAGCG GCTCCGCTCT GTGGAGGAGC AGTGCTCGCC GCCGCTGCGC CTCGCAAATC CCCGGCATTG TCCTCCTGCG CAGCGATTCT  CCGGCCCCCA TGCCTCGCCA GCTCGTCAAT CGCCGCGGAA TCCAGCTTGT TTCGCAGGGT TTGCGGCCTG GGAGTCGCGA AATCGCCGTC CAGGAGGCTT CTTTCCACGA GCTGCAAGCT  GAGCCAGGGC GATGTTCTCC CCTCGTTCAA TCTCAAGGAC CAGGAGGGGC GAGTGGTGAA TTCATCCAAG TTTAAGAACA AGCCCGTGGT CTTGTACTTC TATCCGGCCG ATGAGTCGCC  AGGATGCACC AAAGAGGCTT GCGCGTTTCG GGATTCTTAC GATAAATTCA GGAAGGCTGG AGCGGAAGTG ATTGGCATCA GTGCCGATAC TCCAGAGTCT CACAAGGCAT TCGCGAAGAA  ATACCGGCTT CCATTCACGC TGCTCACCGA CGAAGGAAAC AAGCTAAGAA AGGACTGGGG AATCCCCGGC GACTTCTTTG GCTCGCTGCC GGGAAGGCAA ACTTACGTGA TCGACAAAAA  GGGTGTTGTG CGGCTCGTCT TCAACAACCA GTTCCAGCCC GAGAAGCACG CCATGGAGAC GCTCAAGGTT CTCGAAAGCA TGTAAAGAAA AGCCGCCATT CTTTTCATCG CACCTTCCCT 
TCTATATAAA TATGTAAAAC CCGATGTTGC TGTGGACTTC TCCACGCAGA AAATCTCTTG GAATGAAAAA TTCCAAGCTT TGCCTGCTAT AATCTCTCGC AGTGGAATGC TTTAGT 

Retrieve as FASTA