1. Browse the Database
  2. View Redoxidase
Entry information : SmPrxQ-1_21 (SmPrxQa_21)
Entry ID 6219
Creation 2008-07-07 (Christophe Dunand)
Last sequence changes 2012-04-26 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2012-04-26 (Christophe Dunand)
Peroxidase information: SmPrxQ-1_21 (SmPrxQa_21)
Name (synonym) SmPrxQ-1_21 (SmPrxQa_21)
Class Atypical 2-Cysteine peroxiredoxin (type Q)    [Orthogroup: PrxQ001]
Taxonomy Eukaryota Viridiplantae Streptophyta Isoetopsida Selaginellaceae Selaginella
Organism Selaginella moellendorffii    [TaxId: 88036 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value SmPrxQ-1_21
start..stop		 S start..stop
SmPrxQ-2_31 444 1.25e-161 1..220 1..220
PabPrxQ23 277 1.15e-95 59..220 58..219
PabPrxQ22 272 8.95e-94 63..220 63..219
GbPrxQ01 268 5.67e-92 63..220 66..222
Gene structure Fichier Exons►


exon

Literature and cross-references SmPrxQ-1_21 (SmPrxQa_21)
Literature Richardson,P., Lucas,S., Rokhsar,D., Wang,M. and Lindquist,E.A. DOE Joint Genome Institute Selaginella moellendorffii EST project. Unpublished (2008).
DNA ref. Phytozome 12:   scaffold_21 (1420112..1421465)
mRNA ref. Phytozome 12:   148953 [Incorrect prediction]
EST ref. GenBank:   FE446757.1
Cluster/Prediction ref. UniGene:   Smo.828
Protein sequence: SmPrxQ-1_21 (SmPrxQa_21)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   220 (304)
PWM (Da):   %s   23609.23 (32698.1) Transmb domain:   %s   o362-384i505-527o569-591i
PI (pH):   %s   9.93 (4.45) Peptide Signal:   %s   cut: 19 range:19-322
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MASSSAAPLCGGAVLAAAAPRKSPALSSCAAILRPPCLASSSIAA
ESSLFRRVCGLGVAKSPSRRLLSTSCKLSQGDVLPSFNLKDQEGRVVNSSKFKNKPVVLYFYPADESPGCTKEACAFRDSYDKFRKAGAEVIGISADTPESHKAFAKKYRLPFTLLTDEGNKLRKDWGIPGDFFGSLPGRQTYVIDK
KGVVRLVFNNQFQPEKHAMETLKVLESM*

Retrieve as FASTA  
Remarks Complete sequence from genomic (3 introns) and 32 ESTs. Unigene compiles ESTs from both haplotypes. incorrect prediction from Phytozome (first exon is missing)
DNA ►
Send to BLAST
CDS►
Send to BLAST
cDNA►
Send to BLAST