Entry information : PpaPrx42
Entry ID 6315
Creation 2008-08-06 (Christophe Dunand)
Last sequence changes 2010-06-07 (Christophe Dunand)
Sequence status complete
Reviewer Qiang Li
Last annotation changes 2012-01-05 (Qiang LI)
Peroxidase information: PpaPrx42
Name PpaPrx42
Class Class III peroxidase    [Orthogroup: Prx338]
Taxonomy Eukaryota Viridiplantae Streptophyta Funariaceae Physcomitrella
Organism Physcomitrella patens    [TaxId: 3218 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value PpaPrx42
start..stop
S start..stop
PpaPrx04 421 1.73e-149 2..311 9..318
PpaPrx67 291 9.33e-100 143..312 36..204
PpaPrx67 111 1.07e-29 17..75 17..75
ShPrx02 285 5.91e-96 5..311 7..319
PabPrx151 284 3.36e-95 5..312 18..342
Gene structure Fichier Exons


exon

Literature and cross-references PpaPrx42
Literature REFERENCE 1 Fujita,T., Nishiyama,T., Shin-i,T., Kohara,Y. and Hasebe,M. Physcomitrella patens EST at a stage of the first asymmetric cell division of protoplasts. Unpublished (2005).
REFERENCE 2 Rensing,S. et al., The genome of the moss Physcomitrella patens reveals evolutionary insights into the conquest of land by plants. Science (2008).
DNA ref. Phytozome 12:   scaffold_43 (1325422..1324073)
EST ref. GenBank:   BJ949062 [5' end]  BJ959971 [3' end]
Protein sequence: PpaPrx42
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   312 (291)
PWM (Da):   %s   32717.8 (30664.6)  
PI (pH):   %s   8.22 (8.22) Peptide Signal:   %s   cut: 22 range:22-312
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MLSVLALLVASLAALSTTVQAQLVENFYRTSCPSAETVITSAVNS
ALNRRAASAAGVLRIHFHDCFVH
GCDASVLIDSPSEKDAPPNGSLQGFEVIDAAKTAIEKRCPGIVSCADITAMASQIAVKKLSGGKITWKVPLGRRDGLVSSAADVAGKLPAPTANVATLKSIFAGVGLTTEEMVVLSGAHS
VGVASCRAVQNRLTTPPDATLDPTYAQALQRQCPAGSPNNVNLDVTTPTRLDEVYFKNLQARKGLLTSDQVLHEDPETKPMVAKHTSQGVFNEAFKNAMRKMSDIGVLTGSAGEIRANCH
RFNA*

Retrieve as FASTA  
Remarks Complete sequence from genomic (introns 1 and 2) and 2 ESTs. Also found in contig NZ_ABEU01017182.1 (3' end).
DNA
Send to BLAST
CDS
Send to BLAST