Entry information : PpaPrxQ01
Entry ID 6324
Creation 2008-08-08 (Christophe Dunand)
Last sequence changes 2011-02-02 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2011-02-02 (Christophe Dunand)
Peroxidase information: PpaPrxQ01
Name PpaPrxQ01
Class Atypical 2-Cysteine peroxiredoxin (type Q)    [Orthogroup: PrxQ001]
Taxonomy Eukaryota Viridiplantae Streptophyta Funariaceae Physcomitrella
Organism Physcomitrella patens    [TaxId: 3218 ]
Cellular localisation N/D
Tissue type Protonema
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value PpaPrxQ01
start..stop
S start..stop
PpaPrxQ02 299 2.31e-104 1..218 1..218
MpalPrxQ 257 9.88e-88 11..218 18..214
MpPrxQ01 254 6.63e-87 5..218 2..214
WmPrxQ 254 1.14e-86 6..218 11..223
Gene structure Fichier Exons


exon

Literature and cross-references PpaPrxQ01
Literature REFERENCE 1 Rensing,S.A. et al., The Physcomitrella genome reveals evolutionary insights into the conquest of land by plants. Science 319 (5859), 64-69 (2008).
REFERENCE 2 Fujita,T., Nishiyama,T., Shin-i,T., Kohara,Y. and Hasebe,M. Physcomitrella patens EST at a stage of the first asymmetric cell division of protoplasts.
DNA ref. Phytozome 12:   scaffold_95 (290862..289423)
Cluster/Prediction ref. UniGene:   Ppa.7395
Protein sequence: PpaPrxQ01
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   219
PWM (Da):   %s   23560.13 Transmb domain:   %s   i13-35o50-72i101-123o138-160i173-195o
PI (pH):   %s   9.61
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MATSASCSLAIAAAGAANTSQPTRNHGTARPVASATFVNSELFSSKAGLSARVAGASFHVKSRHTSPLTICKISKGDIVPPVGLKDEEGKLVNLDKFRGKPLVLYFYPADESPACTRQAC
SFRDSYEKFKKAGAEVVGVSGDTPESHK
AFKAKYRLPFTLLSDDGNKLRKDWGVPSDLFGALAGRQTYVIDKDGKVQFIFNNQFEPEKHIAETLNFLKG*

Retrieve as FASTA  
Remarks Complete sequence from genomic (2 intron) and 21 ESTs. Ecotype="Gransden 2004".
DNA
Send to BLAST
CDS
Send to BLAST