Entry information : UmPrxQ02
Entry ID 6360
Creation 2008-09-22 (Christophe Dunand)
Last sequence changes 2008-09-22 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2012-04-03 (Catherine Mathe (Scipio))
Peroxidase information: UmPrxQ02
Name UmPrxQ02
Class Atypical 2-Cysteine peroxiredoxin (type Q)    [Orthogroup: PrxQ001]
Taxonomy Eukaryota Fungi Basidiomycota Ustilaginomycetes Ustilaginaceae Ustilago
Organism Ustilago maydis    [TaxId: 5270 ]
Cellular localisation N/D
Tissue type Germinating teliospore
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value UmPrxQ02
start..stop
S start..stop
PcarPrxQ02 143 1.73e-43 9..187 29..214
HanPrxQ02 143 1.11e-42 2..197 83..270
LbiPrxQ02 141 2.46e-42 2..197 7..223
PplPrxQ02 137 1.04e-40 2..197 8..224
Gene structure Fichier Exons


exon

Literature and cross-references UmPrxQ02
Literature REFERENCE 1 Kamper,J., et al.,Insights from the genome of the biotrophic fungal plant pathogen Ustilago maydis. Nature 444 (7115), 97-101 (2006).
REFERENCE 2 Sacadura,N.T. and Saville,B.J. Gene expression and EST analyses of Ustilago maydis germinating teliospores. Fungal Genet. Biol. 40 (1), 47-64 (2003).
DNA ref. JGI genome:   contig_1_176 (17851..17171)
EST ref. GenBank:   EH028102.1 [5' end]
Protein sequence: UmPrxQ02
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   201 (297)
PWM (Da):   %s   21180.16 (32825.6)  
PI (pH):   %s   10.53 (8.90) Peptide Signal:   %s   cut: 27 range:27-323
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MTTEATGPRRSARNAGKPAASASASARAPVAVKRKAASSNAGDKR
AKLDSQPASIAKVLEIGDALPSLKLKLDDSSELDTATLKNVVLF
SYPRANTSGCTTQAKLYRDNHAAFTRANYTVYGLSNDAPSSLSSWKSKLSLPYNLISDPQRLLIKALTGSNDKTKRSHFVIDANAKLALAQLSVKPAESCESALAFVQPKSD

Retrieve as FASTA  
Remarks Complete sequence from genomic (chromo 17, 1 introns) and 4 ESTs. Strain="521".
DNA
Send to BLAST
CDS
Send to BLAST