Entry information : FmeMnP01 (mnp1 / MnP1-long)
Entry ID 6380
Creation 2008-10-04 (Ingo Morgenstern)
Last sequence changes 2011-10-14 (Christophe Dunand)
Sequence status complete
Reviewer Nizar Fawal
Last annotation changes 2012-10-29 (Nizar Fawal)
Peroxidase information: FmeMnP01 (mnp1 / MnP1-long)
Name (synonym) FmeMnP01 (mnp1 / MnP1-long)
Class Manganese peroxidase    [Orthogroup: MnP003]
Taxonomy Eukaryota Fungi Basidiomycota Agaricomycetes Hymenochaetaceae Fomitiporia
Organism Fomitiporia mediterranea    [TaxId: 208960 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value FmeMnP01
start..stop
S start..stop
FmeMnP08 543 0 1..370 1..366
FmeMnP11 464 8e-165 2..365 1..360
FmeMnP02 462 4e-164 2..370 1..366
FmeMnP10 448 2e-158 2..365 1..360
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 212489..212554 66 N° 2 212310..212427 118 N° 3 212185..212248 64 N° 4 212069..212133 65
N° 5 211907..212010 104 N° 6 211391..211852 462 N° 7 211162..211336 175 N° 8 211039..211100 62
complement(join(211039..211100,211162..211336,211391..211852,211907..212010,2120 69..212133,212185..212248,212310..212427,212489..212554))


exon

Literature and cross-references FmeMnP01 (mnp1 / MnP1-long)
Literature Morgenstern, I., S. Klopman, and D.S. Hibbett. 2008. Molecular evolution and diversity of lignin degrading heme peroxidases in the Agaricomycetes. J Mol Evol. 66(3): 243-257.
Protein ref. UniProtKB:   A7U4R8
DNA ref. JGI genome:   scaffold_20 (212554..211039)
Protein sequence: FmeMnP01 (mnp1 / MnP1-long)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   371 (353)
PWM (Da):   %s   39207.23 (37387.2)  
PI (pH):   %s   4.54 (4.48) Peptide Signal:   %s   cut: 19 range:19-371
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MVFKLSVAFIALASLASAATLKRAACPGGKHTAKNPACCVFFDLADTLQTDQFFNNECGEHAHESLRLTFHDAIGFSASGKLKGNGADGSIMLFADTDKTELNPANAGIDDSVDLLSPLLHSFNVTAGDLIQFAGAVVSNCPGAPQLEFLAGRPNATIPAQQGTVPLPQDPVGKILARMADAGLSAEDTVNLLASHSVARSDTLIPGETAVPFDTTPFTFDSQIFLEVLLKGTGLPFGKNNSDGAEVLSPLPDEGEMRLQSDFAIARDPQTACFWQDMINQQSHMMTAFQTSMKKMAILGHDRNQLIDCSEAVPAPKAKFTKSITFPATKNFSDIQQVCNHPFPTLSTDPGAETTIPSCPPGEATCDES

Retrieve as FASTA  
Remarks Completesequence from genomic DNA. Strain="MF3/22" grown on Vitis vinifera (cv. Mueller-Thurgau), Germany
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGTGTTCAAGCTCTCTGTTGCATTTATTGCTCTCGCTTCATTGGCTAGTGCGGCCACACTCAAGGTGCTGTTCATTTTGCATAGTTACTGCTCGTGACTAATCGTATGTTTTGATCGA
CCTTCAGAGGGCTGCATGTCCAGGCGGCAAGCATACTGCTAAGAACCCTGCGTGCTGTGTATTCTTCGACCTCGCCGACACACTTCAGACCGACCAGTTCTTTAACAATGAATGTGGAGA
ACACG
GTATGTCAATTTCATTCTTCATGCATACATCCATGCATCTAATGATTTTTGTGCTTAACAGCTCACGAGTCTCTGCGCCTGACGTTCCATGACGCTATCGGTTTTTCGGCCAGTG
GAAAGCTGAA
GTATGTAGAACTGTTCGACTATTCAATGACTTATACTTACATTCTTCGTAGGGGAAATGGTGCCGATGGCTCGATCATGCTGTTCGCCGACACGGACAAAACCGAACTCA
ATGATC
GTGAGTTATTTTCAGCTCCTGATTCTCCACTTTGATCTATCTAACTCTTTGGCTATAGCTGCCAACGCCGGCATCGATGATTCAGTCGATTTGCTCTCGCCTCTCCTCCATAGC
TTCAATGTCACGGCCGGGGATCTCATCCAATTTGCGGGAGCAGTTGCC
GTATGTATTTTTCGTGATGATTTTCTGTGGAAAGTTATTGACTTATCGTGACAGGTTTCGAACTGTCCAGGA
GCACCTCAACTCGAGTTCCTCGCAGGCCGTCCCAACGCGACTATCCCTGCACAACAGGGCACCGTTCCTCTGCCACAAGACCCTGTTGGCAAGATTCTTGCTCGTATGGCAGATGCGGGG
CTCAGTGCAGAAGACACAGTCAATCTTCTTGCTTCGCACTCCGTTGCGCGTTCCGACACGCTCATACCGGGAGAAACGGCTGTTCCCTTCGACACGACGCCTTTTACCTTTGATTCGCAG
ATCTTCCTTGAAGTTTTGCTCAAGGGTACGGGTCTCCCCTTCGGTAAAAACAACTCCGACGGTGCAGAAGTTCTGTCGCCACTCCCCGACGAAGGCGAGATGCGCTTGCAATCTGACTTT
GCGATTGCGCGTGACCCGCAGACAGCGTGCTTCTGGCAGGACATGATCAACCAACAATCTCACATGATGACGGCATTCCAAACG
GTTAGTCCTTCACTTTCGTCTTTTTAATCAACACGG
CACTGAACGAATAATCAGTCCATGAAGAAGATGGCAATCCTCGGTCATGACAGGAACCAACTCATCGACTGCTCGGAAGCTGTCCCCGCACCGAAGGCGAAATTTACCAAGTCAATCACT
TTTCCTGCTACGAAGAACTTCTCGGATATCCAGCAAGTCTGCAACCATCCCTTCCCTACTCTTTCTACGGACC
GTGAGTACTCCTGTCTTTGACAAGTGCTACATTATCGCACCTAACTT
TTTTCCTATTTCAGCTGGTGCCGAAACGACGATCCCTTCCTGCCCTCCTGGCGAAGCAACCTGCGACGAATCTTGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGTGTTCAAGCTCTCTGTTGCATTTATTGCTCTCGCTTCATTGGCTAGTGCGGCCACACTCAAGAGGGCTGCATGTCCAGGCGGCAAGCATACTGCTAAGAACCCTGCGTGCTGTGTA
TTCTTCGACCTCGCCGACACACTTCAGACCGACCAGTTCTTTAACAATGAATGTGGAGAACACG
CTCACGAGTCTCTGCGCCTGACGTTCCATGACGCTATCGGTTTTTCGGCCAGTGGA
AAGCTGAA
GGGAAATGGTGCCGATGGCTCGATCATGCTGTTCGCCGACACGGACAAAACCGAACTCAATGATCCTGCCAACGCCGGCATCGATGATTCAGTCGATTTGCTCTCGCCTCTC
CTCCATAGCTTCAATGTCACGGCCGGGGATCTCATCCAATTTGCGGGAGCAGTTGCC
GTTTCGAACTGTCCAGGAGCACCTCAACTCGAGTTCCTCGCAGGCCGTCCCAACGCGACTATC
CCTGCACAACAGGGCACCGTTCCTCTGCCACAAGACCCTGTTGGCAAGATTCTTGCTCGTATGGCAGATGCGGGGCTCAGTGCAGAAGACACAGTCAATCTTCTTGCTTCGCACTCCGTT
GCGCGTTCCGACACGCTCATACCGGGAGAAACGGCTGTTCCCTTCGACACGACGCCTTTTACCTTTGATTCGCAGATCTTCCTTGAAGTTTTGCTCAAGGGTACGGGTCTCCCCTTCGGT
AAAAACAACTCCGACGGTGCAGAAGTTCTGTCGCCACTCCCCGACGAAGGCGAGATGCGCTTGCAATCTGACTTTGCGATTGCGCGTGACCCGCAGACAGCGTGCTTCTGGCAGGACATG
ATCAACCAACAATCTCACATGATGACGGCATTCCAAACG
TCCATGAAGAAGATGGCAATCCTCGGTCATGACAGGAACCAACTCATCGACTGCTCGGAAGCTGTCCCCGCACCGAAGGCG
AAATTTACCAAGTCAATCACTTTTCCTGCTACGAAGAACTTCTCGGATATCCAGCAAGTCTGCAACCATCCCTTCCCTACTCTTTCTACGGACC
CTGGTGCCGAAACGACGATCCCTTCC
TGCCCTCCTGGCGAAGCAACCTGCGACGAATCTTGA

Retrieve as FASTA