Entry information : Sm1CysPrx02-1_0 (Sm1CysPrx02a_0)
Entry ID 6382
Creation 2008-10-10 (Christophe Dunand)
Last sequence changes 2011-02-01 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2011-02-01 (Christophe Dunand)
Peroxidase information: Sm1CysPrx02-1_0 (Sm1CysPrx02a_0)
Name (synonym) Sm1CysPrx02-1_0 (Sm1CysPrx02a_0)
Class 1-Cysteine peroxiredoxin    [Orthogroup: 1CysPrx001]
Taxonomy Eukaryota Viridiplantae Streptophyta Isoetopsida Selaginellaceae Selaginella
Organism Selaginella moellendorffii    [TaxId: 88036 ]
Cellular localisation N/D
Tissue type Whole plant
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value Sm1CysPrx02-1_0
start..stop
S start..stop
Sm1CysPrx02-2_8 458 3e-167 1..220 1..220
Egu1CysPrx03 322 2e-113 1..220 1..220
Egr1CysPrx03 322 2e-113 1..220 1..220
Lu1CysPrx219 321 5e-113 1..220 1..220
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 4543872..4543989 118 N° 2 4544052..4544200 149 N° 3 4544285..4544431 147 N° 4 4544502..4544750 249
join(4543872..4543989,4544052..4544200,4544285..4544431,4544502..4544750)


exon

Literature and cross-references Sm1CysPrx02-1_0 (Sm1CysPrx02a_0)
Literature Richardson,P., Lucas,S., Rokhsar,D., Wang,M. and Lindquist,E.A. DOE Joint Genome Institute Selaginella moellendorffii EST project. Unpublished (2008).
DNA ref. Phytozome 12:   scaffold_0 (4543872..4544750)
EST ref. GenBank:   FE461036.1 [5' end]
Cluster/Prediction ref. UniGene:   Smo.4755
Protein sequence: Sm1CysPrx02-1_0 (Sm1CysPrx02a_0)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   220
PWM (Da):   %s   24275.24  
PI (pH):   %s   6.93
Sequence 261
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MPGISIGDEIPDIHADSTHGPINLHEFCKNNWTLVFSHPADFTPVCTTELGSVAKYQPEIEKRGAKLLGLSCDTVEEHKAWTKDVEAYTTGACVKYPIMADPTREISRKLNMLDPDEKDSSGQPVASRALHIVGPDCRIRVSFMYPASVGRNFDEVIRVLDALQLSSKHKIACPVNWKPGDHVVISPSVSDEEAKKMFPQGYKTVDLPSGKKYMRLVKVD

Retrieve as FASTA  
Remarks Complete sequence from genomic (3 introns) and 1 ESTs. Unigene compiles ESTs from both haplotypes. Strain="Plant Delights".
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
TGCCAGGCATTTCGATTGGAGATGAGATTCCGGACATCCACGCCGACTCTACTCACGGCCCCATAAATCTTCACGAGTTTTGCAAGAACAACTGGACGCTCGTCTTCTCTCATCCCGGTA
AGAACGTTCTTGTTCCAAGAAGGCAAAAAAAAGAAGCATTTTGCTTCCCCTTCTTTCAGCTGACTTCACTCCGGTTTGCACCACCGAGCTCGGGAGCGTCGCCAAGTACCAGCCCGAGAT
CGAGAAGCGAGGAGCCAAGCTGCTGGGCCTCTCCTGTGATACCGTCGAGGAGCACAAGGCCTGGACCAAGGATGTCGAAGCTTACACG
GTGCGCGTCTTCCAACTCTCGCTGCAGTGCAG
TGATCTTATACCTATACCTTCCATCTGTTTTCTCTGTGACTCCGGGAACTAGACTGGAGCTTGCGTCAAGTACCCCATCATGGCCGATCCGACCCGGGAGATCTCCAGGAAGCTCAACAT
GCTCGATCCGGACGAGAAAGATTCCTCGGGCCAGCCGGTTGCTTCGAGGGCTCTTCACATCGTCGGTCCTGACTGTCGG
GTAGGATCCTTTGCATGCTTTCGCTTCTCATCGTCTTCGTT
TCATGCGTTGTCTCTTCTCTCTCTTGCAGATCAGGGTGAGCTTCATGTATCCTGCCTCGGTTGGACGCAACTTTGACGAGGTGATCCGCGTGCTGGATGCGCTGCAGCTCTCCTCCAAGC
ACAAGATTGCCTGCCCCGTTAACTGGAAGCCCGGCGATCACGTCGTCATCTCCCCCTCGGTTTCCGACGAGGAGGCCAAGAAGATGTTCCCCCAGGGATACAAGACGGTCGATCTTCCTT
CCGGGAAGAAGTACATGCGTCTTGTCAAGGTGGATTAG

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
TGCCAGGCATTTCGATTGGAGATGAGATTCCGGACATCCACGCCGACTCTACTCACGGCCCCATAAATCTTCACGAGTTTTGCAAGAACAACTGGACGCTCGTCTTCTCTCATCCCGCTG
ACTTCACTCCGGTTTGCACCACCGAGCTCGGGAGCGTCGCCAAGTACCAGCCCGAGATCGAGAAGCGAGGAGCCAAGCTGCTGGGCCTCTCCTGTGATACCGTCGAGGAGCACAAGGCCT
GGACCAAGGATGTCGAAGCTTACACG
ACTGGAGCTTGCGTCAAGTACCCCATCATGGCCGATCCGACCCGGGAGATCTCCAGGAAGCTCAACATGCTCGATCCGGACGAGAAAGATTCCT
CGGGCCAGCCGGTTGCTTCGAGGGCTCTTCACATCGTCGGTCCTGACTGTCGG
ATCAGGGTGAGCTTCATGTATCCTGCCTCGGTTGGACGCAACTTTGACGAGGTGATCCGCGTGCTGG
ATGCGCTGCAGCTCTCCTCCAAGCACAAGATTGCCTGCCCCGTTAACTGGAAGCCCGGCGATCACGTCGTCATCTCCCCCTCGGTTTCCGACGAGGAGGCCAAGAAGATGTTCCCCCAGG
GATACAAGACGGTCGATCTTCCTTCCGGGAAGAAGTACATGCGTCTTGTCAAGGTGGATTAG

Retrieve as FASTA  
cDNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
GTTTGTTTTG TTGGCTTGAT AATCGCGAGA GAGCAGCATA AGCTAGAGAC AAGATGCCAG GCATTTCGAT TGGAGATGAG ATTCCGGACA TCCACGCCGA CTCTACTCAC GGCCCCATAA  ATCTTCACGA GTTTTGCAAG AACAACTGGA CGCTCGTCTT CTCTCATCCC GCTGACTTCA CTCCGGTTTG CACCACCGAG CTCGGGAGCG TCGCCAAGTA CCAGCCCGAG ATCGAGAAGC  GAGGAGCCAA GCTGCTGGGC CTCTCCTGTG ATACCGTCGA GGAGCACAAG GCCTGGACCA AGGATGTCGA AGCTTACACG ACTGGAGCTT GCGTCAAGTA CCCCATCATG GCCGATCCGA  CCCGGGAGAT CTCCAGGAAG CTCAACATGC TCGATCCGGA CGAGAAAGAT TCCTCGGGCC AGCCGGTTGC TTCGAGGGCT CTTCACATCG TCGGTCCTGA CTGTCGGATC AGGGTGAGCT  TCATGTATCC TGCCTCGGTT GGACGCAACT TTGACGAGGT GATCCGCGTG CTGGATGCGC TGCAGCTCTC CTCCAAGCAC AAGATTGCCT GCCCCGTTAA CTGGAAGCCC GGCGATCACG  TCGTCATCTC CCCCTCGGTT TCCGACGAGG AGGCCAAGAA GATGTTCCCC CAGGGATACA AGACGGTCGA TCTTCCTTCC GGGAAGAAGT ACATGCGTCT TGTCAAGGTG GATTAGATGT 
GTGAAGTCCT GAGTCTTATA TGACTTATCT GCGTGGAAGT AATAATATTA GTAGAGCTTG TTAAG 

Retrieve as FASTA