Entry information : Ppa2CysPrx01
Entry ID 6395
Creation 2008-10-30 (Christophe Dunand)
Last sequence changes 2011-02-02 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2011-02-02 (Christophe Dunand)
Peroxidase information: Ppa2CysPrx01
Name Ppa2CysPrx01
Class Typical 2-Cysteine peroxiredoxin    [Orthogroup: 2CysPrx001]
Taxonomy Eukaryota Viridiplantae Streptophyta Funariaceae Physcomitrella
Organism Physcomitrella patens    [TaxId: 3218 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value Ppa2CysPrx01
start..stop
S start..stop
Ppa2CysPrx02 431 2e-154 36..282 36..282
Mpal2CysPrx01 411 1e-146 1..282 1..275
Mp2CysPrx01 402 4e-143 38..282 34..275
Gb2CysPrx 393 1e-139 1..282 1..279
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 2368256..2368501 246 N° 2 2368812..2368895 84 N° 3 2369312..2369393 82 N° 4 2369648..2369727 80
N° 5 2369946..2370071 126 N° 6 2370306..2370419 114 N° 7 2370772..2370888 117  
join(2368256..2368501,2368812..2368895,2369312..2369393,2369648..2369727,2369946 ..2370071,2370306..2370419,2370772..2370888)


exon

Literature and cross-references Ppa2CysPrx01
Literature Hasebe,M., Nishiyama,T., Suzuki,Y., Sugano,S., Hiwatashi,Y., Kohara ,Y. and Shin-i,T. Expressed genes in Physcomitrella patens. Unpublished (2008).
DNA ref. Phytozome 12:   scaffold_30 (2368256..2370888)
EST ref. GenBank:   DC936445 [5' end]   DC957738 [3' end]
Cluster/Prediction ref. UniGene:   Ppa.5529
Protein sequence: Ppa2CysPrx01
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   282 (300)
PWM (Da):   %s   30066.48 (33077.7)  
PI (pH):   %s   7.5 (8.56) Peptide Signal:   %s   cut: 22 range:22-321
Sequence 323
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MACAAAASGVTLPAGNIAHARPAAFSSSASGASSSLSVRKSFSGLSKSFAARLAATNAPTGKAASAAGVKIASQKRGVITASAQDSYEPLIGNVAPDFEAEAVFDQEFIKVKLSEYIGKKYVVLFFYPLDFTFVCPTEITAFSDRYSEFEKLSTEVIGVSTDSVFSHLAWIQTDRKAGGLGDLHYPIVSDITKKISRSFNVLIPEQGIALRGLFIIDKQGVIQHATVNNLGIGRSVDETLRTLQAVQYVQDNPDEVCPAGWKPGEKTMKPDSKLSKEYFEAI

Retrieve as FASTA  
Remarks Complete sequence from genomic (6 introns) and 18 ESTs (unigene) and 28 not compiled. Strain="Gransden"
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
TGGCGTGTGCTGCAGCAGCCTCCGGCGTCACGCTCCCCGCGGGCAACATCGCCCATGCTCGCCCTGCGGCCTTTTCGTCCTCTGCCTCCGGCGCATCCTCCTCTTTGTCCGTGCGGAAGT
CGTTCTCCGGACTGAGCAAAAGCTTTGCTGCTCGCCTGGCTGCTACCAATGCACCCACTGGCAAGGCTGCTTCGGCAGCTGGAGTCAAGATCGCGTCGCAGAAGCGGGGTGTGATCACTG
CTTCG
GTGAGTGAGATGAGCGAAATTAAGGAGATGGAATGAATAGCGTTAGGCGTTAGGTCAAACTCCTGACAGCAACTTCTTAGCCCAAAATGTGGGTGACTCTTTCGTTGTGGGTGTT
GATGTGTCCTATGGCGATTACTATCCGGGGCTCAGGGTCTACGGATTAATAGATGCTACGTGATGCATGTCGTGAATTCTCCGCCCTTCCGTGTCGCGATTATGTGGATGGTTGCTGGAG
ATCATCGAAGGGTGGGCGGAATAGGGGAGGAGCGTTGTGTGGAGGTAATAACTGGTTTGTGGAGTGTCCATGCAGGCGCAGGACAGCTACGAGCCACTCATTGGTAATGTTGCCCCAGAC
TTCGAGGCGGAGGCTGTGTTCGACCAGGAATTTATTAAG
GCATGTTTCAACCGTTCAGTTTTCCGATCACGGTTCTGGTTGTTGCCGAGTCTCGTGCCTCCCATATGTGCGATTCTGTAT
TCTATTAGAGTATGAAATAGCCATTTCAAGTACTATCCCATTCCTCCAATTTTGTTTTTTACAGTGTCTGTCTCATGGGGCATCTGAGTGAATTTCTGGTCATGTGCGGCTTCGGGAGCA
ACCTTGCTTGTGCAAAGTTTACATTCTATGCCTTCCTAGTTCACACAGCAACTAGTTTCAGCTCGGGGAGCGATTTCGCTTGTACAAGGTATTAGTCATGTCATGTTGTATGTGGCATGG
GAGATCGTGGGAGTAGCTAATTCGGGGAGGTATGTATACAATCATCAATATTACGTTTGTGGATGGACTGACCGATCGGTTTTGCCTACATGCAGGTTAAGCTGTCCGAGTACATTGGAA
AGAAGTACGTCGTATTGTTCTTCTACCCTTTGGACTTCACATTCGTATGTCCAACAG
GTACTCATCGGGTTTTGGATGCCCTTCCTGTCCTGTTCTGTTCAGAGGAGGGGTTAGTCTTCT
TTGCATTAGTGGGGAACATTGGGCAGAGGTGAGCAAGGGGCTGTACAGGGGAGTAGTTTTCCAGTGTTTTTATTTATAGCTCCAACTTTCAAGTCATTGAGATAATTGCGTTTTCGACGG
TAGTGACACACTTCCGGTGTGAATGCTAAGTGATTTGTGAGCTAGATTTAGGCCATAACGTGAGCTTGCAGAAATCACTGCCTTCAGTGACAGGTACAGCGAATTCGAGAAGCTAAGCAC
GGAAGTTATCGGTGTTTCCACTGACAGCGTG
GTATGAATTCATCCTATTTCATCTCAATTGTGTGTCGTGATGTGATGTAGCGGGGGTGAGGGGAACGGTGAGGTGCATGGATGTTGAGG
CGAGATGTGGATCAGAATTGTTTGGATGCGGCTTGTCCTCTGAGATAAGGAATGGACGTAGTGCAGTTTTTGGCTGGTTCCCAGTTGGAGCAGACCCAACTAAGCATGTGACCTTGGCAA
TGGCTGCAGTTCTCTCACCTCGCCTGGATCCAAACTGATAGAAAGGCAGGAGGGCTCGGGGACCTGCATTATCCCATCGTCTCGGACATTACCAAAAAGATTTCTAGGTCATTTAATGTA
CTGATTCCGGAGCAG
GTATTAAAGAGAGTAATAATGGCTTGTTGACTTTGAAGTTTGTTTGCAGTGGAAAATGTTCGTTTTTTTTATTATGTCTTTATTTACTTTGATCAAAACAGTATA
TTATAATACTATTCTATTTGGGTTTTTTTTTGTTTGAAGGGGAGAGAGAGAGNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNTTATCCGGTGGGTGTTCCCCGACTGAGTTGGGATTTA
TTTTGGCAGGGCATCGCACTGAGGGGTCTATTCATCATTGACAAACAGGGAGTGATCCAGCACGCAACCGTCAACAACCTTGGTATTGGGCGAAGCGTTGACGAAACTCTGCGGACTCTG
CAG
GTAGGTGGAAAGGGTAGTCTACTTTGGAACATGCTGAGACTGGGTTTAGAAGCAATTCCCAGTTAGCCTAATGGCACGAGTGGTTTCGGAGTGGAGCTGTTCGTCGCTCAGCGTCTT
CCCATCCTGTAGTTGACAACCTTTAGGAACACCTATAGCATTCCTGAGATTTCGTATGGTACAATCGTCCTTAGATGGAGGGTCCATCTAAGAGCCTCATATCGTATACAATGAACGTGT
AAAGCATTTTGGTGAGGCCGACATAGGATGTTTATCTCGATATTGCAATTGGTACTGGTAGGGCTAATTTTTCTGTTTGTGAGCGTGTGGCTGAAGCTGCTATTTTTGTTCTCAGGCCGT
ACAGTACGTGCAAGATAACCCAGACGAGGTGTGCCCTGCTGGCTGGAAGCCTGGGGAAAAAACGATGAAGCCTGACTCGAAGCTAAGCAAGGAGTATTTCGAGGCCATCTGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
TGGCGTGTGCTGCAGCAGCCTCCGGCGTCACGCTCCCCGCGGGCAACATCGCCCATGCTCGCCCTGCGGCCTTTTCGTCCTCTGCCTCCGGCGCATCCTCCTCTTTGTCCGTGCGGAAGT
CGTTCTCCGGACTGAGCAAAAGCTTTGCTGCTCGCCTGGCTGCTACCAATGCACCCACTGGCAAGGCTGCTTCGGCAGCTGGAGTCAAGATCGCGTCGCAGAAGCGGGGTGTGATCACTG
CTTCG
GCGCAGGACAGCTACGAGCCACTCATTGGTAATGTTGCCCCAGACTTCGAGGCGGAGGCTGTGTTCGACCAGGAATTTATTAAGGTTAAGCTGTCCGAGTACATTGGAAAGAAGT
ACGTCGTATTGTTCTTCTACCCTTTGGACTTCACATTCGTATGTCCAACAG
AAATCACTGCCTTCAGTGACAGGTACAGCGAATTCGAGAAGCTAAGCACGGAAGTTATCGGTGTTTCCA
CTGACAGCGTG
TTCTCTCACCTCGCCTGGATCCAAACTGATAGAAAGGCAGGAGGGCTCGGGGACCTGCATTATCCCATCGTCTCGGACATTACCAAAAAGATTTCTAGGTCATTTAATG
TACTGATTCCGGAGCAG
GGCATCGCACTGAGGGGTCTATTCATCATTGACAAACAGGGAGTGATCCAGCACGCAACCGTCAACAACCTTGGTATTGGGCGAAGCGTTGACGAAACTCTGC
GGACTCTGCAG
GCCGTACAGTACGTGCAAGATAACCCAGACGAGGTGTGCCCTGCTGGCTGGAAGCCTGGGGAAAAAACGATGAAGCCTGACTCGAAGCTAAGCAAGGAGTATTTCGAGG
CCATCTGA

Retrieve as FASTA