1. Browse the Database
  2. View Redoxidase
Entry information : MtGPx07 ( Medtr5g010340.1 [4.0] / Medtr5g010340.1[3.5])
Entry ID 6456
Creation 2009-01-07 (Christophe Dunand)
Last sequence changes 2016-05-04 (Catherine Mathe)
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2016-05-11 (Christophe Dunand)
Peroxidase information: MtGPx07 ( Medtr5g010340.1 [4.0] / Medtr5g010340.1[3.5])
Name (synonym) MtGPx07 ( Medtr5g010340.1 [4.0] / Medtr5g010340.1[3.5])
Class Plant glutathione peroxidase     [Orthogroup: Gpx2003]*
Taxonomy Eukaryota Viridiplantae Streptophyta Fabaceae Medicago
Organism Medicago truncatula (barrel medic)    [TaxId: 3880 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value MtGPx07
start..stop		 S start..stop
CsGPx04 247 2.86e-85 1..168 1..167
NtGPx08-1A 246 6.78e-85 1..168 1..167
CclGPx04 244 4.67e-84 1..168 1..167
MtGPx08 244 7e-84 3..168 5..169
Gene structure Fichier Exons►


exon

Literature and cross-references MtGPx07 ( Medtr5g010340.1 [4.0] / Medtr5g010340.1[3.5])
DNA ref. GenBank:   CT963113.2 (63322..65002) Phytozome 12:   chr5 (2752221..2750541)
Cluster/Prediction ref. Phytozome Gene 12:   31090291 [Incorrect prediction]
Protein sequence: MtGPx07 ( Medtr5g010340.1 [4.0] / Medtr5g010340.1[3.5])
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   177
PWM (Da):   %s   19801.01  
PI (pH):   %s   6.5
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MTPETIGEQKSVFDFYVKDAKGGIANLATYKGKVLLIVNVASQCGLTDSNYAELNQLYDKYKDGFEILAFPCNQFRDQEPETSDKIVEYVCTRFGSKFPIFGIKVNGFHSAPLYKFLKSG
KFGVIFGDDIQWNFAKFLIDKDGQVAARYYPTTSPLSLEHDICQLLCDGKLLCVE*

Retrieve as FASTA  
Remarks Complete sequence from genomic (chromo 4, 5 introns). No EST.
DNA ►
Send to BLAST
CDS►
Send to BLAST