Entry information : ZmPrxII06 (ZmPrxIIF)
Entry ID 6474
Creation 2009-01-15 (Christophe Dunand)
Last sequence changes 2009-01-15 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2010-12-23 (Marie Brette (Scipio))
Peroxidase information: ZmPrxII06 (ZmPrxIIF)
Name (synonym) ZmPrxII06 (ZmPrxIIF)
Class Atypical 2-Cysteine peroxiredoxin (type II)    [Orthogroup: PrxII001]
Taxonomy Eukaryota Viridiplantae Streptophyta Monocotyledons Poaceae Zea
Organism Zea mays    [TaxId: 4577 ]
Cellular localisation N/D
Tissue types Endosperm
Meristems
Pollens
Roots
Seedlings
Shoots
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value ZmPrxII06
start..stop
S start..stop
SbPrxII06 339 6.19e-121 1..193 1..193
OsPrxII06 319 3.7e-113 28..193 33..198
EgrPrxII02 307 1.97e-108 1..193 1..196
EguPrxII02 305 2.01e-107 1..193 1..196
Gene structure Fichierperl './assets/cgi-bin/draw_exon.pl' '6474' 'join(39292343..39292534,39292650..39292679,39293363..39293521,39294149..39294243,39294686..39294791)' Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 39292343..39292534 190 N° 2 39292650..39292679 28 N° 3 39293363..39293521 157 N° 4 39294149..39294243 93
N° 5 39294686..39294791 104  
join(39292343..39292534,39292650..39292679,39293363..39293521,39294149..39294243 ,39294686..39294791)


exon

Literature and cross-references ZmPrxII06 (ZmPrxIIF)
DNA ref. GenBank:   AC210940.3
Cluster/Prediction ref. UniGene:   Zm.2019
Protein sequence: ZmPrxII06 (ZmPrxIIF)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   193 (207)
PWM (Da):   %s   20609.65 (21482.8)  
PI (pH):   %s   8.66 (8.71) Peptide Signal:   %s   cut: 22 range:22-228
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MAATLARRAGRSAATTLWGAARGFASVGSDIVSAAPGVSLQKARS
WDEGVATKFSTTPLKDIFY
GKKVVIFGLPGAYTGVCSQAHVPSYKKNIDKLKAKGIDSVICVAVNDPYVLDGWAKKLDAKDTIEFYGDFDGSFHKSLDLEIDLSAALLGRRSHRWSAFVDDGKIKSFNVEEAPSDFKVS
GAEVILDQI

Retrieve as FASTA  
Remarks Complete sequence from genomic (chromo 3, 3 introns), 6 RNA and 210 ESTs. Also found in AC203784.3.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCGGCGACGCTGGCGAGGAGGGCGGGGCGCTCCGCGGCGACGACGCTATGGGGCGCGGCGAGGGGCTTCGCATCGGTGGGGTCCGACATCGTCTCTGCGGCTCCCGGCGTGTCGCTG
CAGAAGGCGCGGTCCTGGGACGAGGGCGTCGCCACCAAGTTCTCTACCACGCCTCTCAAGGACATCTTCTAC
ACGTTCGTAGCGCCGCTCCTCCTCCACCGCTCGTGTCGTCTTCTGCTA
GATAGTCCATACAGGCCAATTCAGTCGTGTTGACCCGGGATTCTTTGCTTGCTGTCCTTGTGCTTGCAGGGGAAGAAGGTGGTCATCTTCGGCTTGCCCCCGTAAGTTCCCCTCCCCACT
ACTTCCATTCTGCTCTCCATGTACATGTCTGGTCATTTAGGATCGCTAGATGAGGCCTTTATTTACATTGGTGCGGAATTGTTTTACTAGGTTTGCTAGTCCTGAATCTACATTTGGGAA
TTAGGGATGCCTCAGCGGAACGTTAATCATGGGTTTTTTTTTTTTTTTTTTTGCTGTTAGAACGATCTGGGAAATATACGTAGGAATTGGGAATGGGAAGTTATGTTGTTTCAGTGACCA
TGGTGAAATCCGAATGATGTATCTTATATATATTAGATGACGTTTCTACAAACTAGAGGTGTTCATCTCTGATGCCTAGGAGAAAACATTACATTTCATTCGTCTCATCTGATGTGGCAA
CAAGGATAGGTGTACTCCATTATACTCAATGACAATGTTGTAAGAGCATAACACAGAATCCATGTTTCTTTTTCTAAGCCATGACAAAAAATTGTGATTGTGACACATTACACCCTACTC
CCAGAGTTTCTAGTCATTGTTGTTTACTTGGCGATCCAGTCCATTGGAATTTGTAAATTTACACCTTTGGTATTGTTTTTTCGTATTGCCTTTCTCTATATTTTATTCTGAAAGGCAGAA
TTATCTCTCTTCAAATGTTCTAATGACTACATGGTTTGGCAACTGTCTTTTCAATTTATTGAAGGGTGCATATACAGGGGTTTGTTCACAAGCGCACGTTCCTAGTTACAAGAAGAATAT
TGACAAGTTGAAAGCAAAAGGAATCGACTCTGTTATCTGTGTAGCTGTGAATGATCCGTATGTCCTGGATGGATGGGCAAAAAAGCTAGACGCTAAAGATACA
CAGTAAGTAGCTATCCT
TTAATCTTTATTCTTTATATGTCTTATTAGCAATTTAGCTCATAATCTGAAATATAATGAGGGCATATAACATGTGTATCCAAGTATTGTGCTATTATCAATGTATAGGACTATTTGCCT
TTTGCTGTCAGGTGTTGGTGCTTATTTGGAGTTCCAACTACATAAATGTTTGTCGTCATTATATTCCCTTCCTACTCTCAGTAATTCGTTACTACTTACTACTAAGGATTGTCCAATATG
CCATCAACATGTGATGTTTTCCTTGTTCTGCCACCTAATATGCTTAATCACAGCCCTAAATTATTGATACTGTACATCAAATATGGTGCTTTTTCATACTTATGCTGCACTTCACCTTGG
TGCATAAAACTACCAAATGCAAATTTCATGCTGTGTCTCATAAAGCTCACCCAAATTTCTTTATACTGATGAATGATCTAATTTAAACTTAGAATTTATGGGAAACATGTTTGGTGTATC
ATCTTAGGATCTTAATGAAAAAAACTATGAATTGAGTATGTGCAGTTGCTACTTATTATCTATATTAATTCTCTCGAGATCATGTGCATATTCATATTTTTTTTCTATGTGCAATTATTT
TGGAAAATATAGATTGAGTTCTATGGTGACTTTGATGGGAGTTTCCACAAAAGCTTGGATTTGGAGATAGACCTTTCTGCTGCTTTGCTTGGCCGCCGTTCTCACAGAGGTTAATGGACT
CAACTTGCAGAGATTATCAAACTGCTGCCTTTATATTACAGTTGAAGAATTGTGTTATGTAGTTTAATACTGAGTTACTTATCACACTGCCTGATTAGCAAAGCTCCGTTGTCTTCTGAG
CTCTGACAAATTTGTCCTTGTTTAGTCAAATGTCTCTCTGGACACTTTATGTAATTTATTTCCACCACAGCAGAACCGGGTGCTATGGCTGCATAGGAAATTGTGAATGACCACCATATG
GTGAAATGTTGCTTTCGTTTCACTAGGTTGATAATATAATACTGTAGAAGACATCCCAGCCTTACATGATAACAACCGTTCTTAGAGTATCTTTTAAATTTCTCGACTAAGCAAGGAGTG
CGTATGAGTAATGACAATCCATCTTATGCTTGGTTTCTGTCTTCTGGTCTAAACCTTGACAACATTTTTAGGTGGTCCGCCTTTGTTGACGATGGTAAGATCAAGTCTTTCAATGTTGAG
GAAGCACCGTCCGACTTTAAGGTTTCTGGTGCGGAGGTGATCTTGGACCAGATCTGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCGGCGACGCTGGCGAGGAGGGCGGGGCGCTCCGCGGCGACGACGCTATGGGGCGCGGCGAGGGGCTTCGCATCGGTGGGGTCCGACATCGTCTCTGCGGCTCCCGGCGTGTCGCTG
CAGAAGGCGCGGTCCTGGGACGAGGGCGTCGCCACCAAGTTCTCTACCACGCCTCTCAAGGACATCTTCTAC
GGGAAGAAGGTGGTCATCTTCGGCTTGCCCGGTGCATATACAGGGGTT
TGTTCACAAGCGCACGTTCCTAGTTACAAGAAGAATATTGACAAGTTGAAAGCAAAAGGAATCGACTCTGTTATCTGTGTAGCTGTGAATGATCCGTATGTCCTGGATGGATGGGCAAAA
AAGCTAGACGCTAAAGATACA
ATTGAGTTCTATGGTGACTTTGATGGGAGTTTCCACAAAAGCTTGGATTTGGAGATAGACCTTTCTGCTGCTTTGCTTGGCCGCCGTTCTCACAGGTGG
TCCGCCTTTGTTGACGATGGTAAGATCAAGTCTTTCAATGTTGAGGAAGCACCGTCCGACTTTAAGGTTTCTGGTGCGGAGGTGATCTTGGACCAGATCTGA

Retrieve as FASTA