Entry information : Pinv1CysPrx
Entry ID 6503
Creation 2009-01-20 (Christophe Dunand)
Last sequence changes 2009-01-20 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2012-04-06 (Catherine Mathe (Scipio))
Peroxidase information: Pinv1CysPrx
Name Pinv1CysPrx
Class 1-Cysteine peroxiredoxin    [Orthogroup: 1CysPrx001]
Taxonomy Eukaryota Fungi Basidiomycota Agaricomycetes Paxillaceae Paxillus
Organism Paxillus involutus    [TaxId: 71150 ]
Cellular localisation N/D
Tissue type Mycelium
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value Pinv1CysPrx
start..stop
S start..stop
Tcam1CysPrx 390 3e-140 1..220 1..221
Athi1CysPrx01 387 4.87e-139 1..221 1..220
Hcy1CysPrx 387 6.67e-139 1..220 1..219
Ppl1CysPrx01-1A 385 1.84e-138 1..220 1..221
Gene structure Fichier Exons


exon

Literature and cross-references Pinv1CysPrx
Literature Stephen,S.A., Caillau,M., Wright,D.P., Johansson,T., Tunlid,A., Soderstrom,B., Read,D.J. and Scholes,J.D. Transcriptional programmes for nutrient acquisition by the ectomycorrhizal fungus Paxillus involutus.
DNA ref. JGI genome:   scaffold_3 (1259992..1260983)
EST ref. GenBank:   EW971140 [5' end]  CN072162.1 [3' end]
Protein sequence: Pinv1CysPrx
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   222
PWM (Da):   %s   24790.77  
PI (pH):   %s   6.25
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MPSLRLGSIAPDFPAETTAGSINFHEWIGDSWAILFSHPGDFTPVCTTELGEVARRADDFAKRNVKVIGISANGLDDHKAWVQDINEYGAKYGPTEVRFPIIADADRKISTLYDMLDEQD
ATNRDDKGLPFT
IRTVFVIDPKKVIRLTISYPASTGRNFDEVLRVISLQLGDKHRVTTPVNWKKGDDVIVHPAVKNDEAKQLFPQVTFHKQPYLRTTPLTE

Retrieve as FASTA  
Remarks Complete sequence from 29 ESTs. Strain="ATCC200175".
DNA
Send to BLAST
CDS
Send to BLAST