1. Browse the Database
  2. View Redoxidase
Entry information : LbiHalPrx01
Entry ID 6514
Creation 2009-01-23 (Christophe Dunand)
Last sequence changes 2009-01-23 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2012-04-06 (Catherine Mathe (Scipio))
Peroxidase information: LbiHalPrx01
Name LbiHalPrx01
Class Haloperoxidase (haem)    [Orthogroup: HalPrx001]
Taxonomy Eukaryota Fungi Basidiomycota Agaricomycetes Tricholomataceae Laccaria
Organism Laccaria bicolor    [TaxId: 29883 ]
Cellular localisation N/D
Tissue types Mycelium
Sporocarp (fruiting body)
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value LbiHalPrx01
start..stop		 S start..stop
LbiHalPrx02 486 4.96e-176 1..291 1..293
CcinHalPrx01 388 4.95e-137 7..284 3..281
CcinHalPrx02 376 1.89e-132 7..273 4..271
SlutHalPrx05 372 4.76e-131 1..285 1..285
Gene structure Fichier Exons►


exon

Literature and cross-references LbiHalPrx01
DNA ref. JGI genome:   LG_1 (2148783..2149838)
EST ref. GenBank:   EX795804.1 [5' end]  EX795803.1 [3' end]
Protein sequence: LbiHalPrx01
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   292 (300)
PWM (Da):   %s   31933.92 (32432.2)  
PI (pH):   %s   5.38 (5.68) Peptide Signal:   %s   cut: 24 range:24-323
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MFLVTPIARAIQDAGIFSWDLGLTLINFVTPSRKVDHVTPAGHPG
AGGTWPEYIPPTEGDSRCSCPALNAMANHGILPRDGKNISFPEMNSTIRATYNFAPSFCFFVPNFAARMLNKSYGKDRFDLADLDLHNGIEHDASLTREDLHFVKDQGKPHLPFVRELLDSASGKDKDGNVLLTPADLSRYSAKRRAES
RANNPEFSLDLFHKMFGSSNSSTLLTVFGGRVSDLESILIDERFPEGWESRVREPFGLTIASFQPTVLKVEFGIDESKYAAEASSTAAVESGEPNPAA

Retrieve as FASTA  
Remarks Complete sequence from genomic (3 introns) and 4 ESTs. Duplication.
DNA ►
Send to BLAST
CDS►
Send to BLAST