Entry information : LbiHalPrx01
Entry ID 6514
Creation 2009-01-23 (Christophe Dunand)
Last sequence changes 2009-01-23 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2012-04-06 (Catherine Mathe (Scipio))
Peroxidase information: LbiHalPrx01
Name LbiHalPrx01
Class Haloperoxidase (haem)    [Orthogroup: HalPrx001]
Taxonomy Eukaryota Fungi Basidiomycota Agaricomycetes Tricholomataceae Laccaria
Organism Laccaria bicolor    [TaxId: 29883 ]
Cellular localisation N/D
Tissue types Mycelium
Sporocarp (fruiting body)
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value LbiHalPrx01
start..stop
S start..stop
LbiHalPrx02 486 4.95e-176 1..291 1..293
CcinHalPrx01 388 4.93e-137 7..284 3..281
CcinHalPrx02 376 1.88e-132 7..273 4..271
SlutHalPrx05 372 4.75e-131 1..285 1..285
Gene structure Fichierperl './assets/cgi-bin/draw_exon.pl' '6514' 'join(2148783..2149005,2149066..2149269,2149330..2149543,2149601..2149838)' Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 2148783..2149005 221 N° 2 2149066..2149269 202 N° 3 2149330..2149543 212 N° 4 2149601..2149838 236
join(2148783..2149005,2149066..2149269,2149330..2149543,2149601..2149838)


exon

Literature and cross-references LbiHalPrx01
DNA ref. JGI genome:   LG_1 (2148783..2149838)
EST ref. GenBank:   EX795804.1 [5' end]  EX795803.1 [3' end]
Protein sequence: LbiHalPrx01
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   292 (300)
PWM (Da):   %s   31933.92 (32432.2)  
PI (pH):   %s   5.38 (5.68) Peptide Signal:   %s   cut: 24 range:24-323
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MFLVTPIARAIQDAGIFSWDLGLTLINFVTPSRKVDHVTPAGHPG
AGGTWPEYIPPTEGDSRCSCPALNAMANH
GILPRDGKNISFPEMNSTIRATYNFAPSFCFFVPNFAARMLNKSYGKDRFDLADLDLHNGIEHDASLTREDLHFVKDQGKPHLPFVRELLDSASGKDKDGNVLLTPADLSRYSAKRRAES
RANNPEFSLDLFHKMFGSS
NSSTLLTVFGGRVSDLESILIDERFPEGWESRVREPFGLTIASFQPTVLKVEFGIDESKYAAEASSTAAVESGEPNPAA

Retrieve as FASTA  
Remarks Complete sequence from genomic (3 introns) and 4 ESTs. Duplication.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGTTCCTCGTAACCCCAATCGCCCGAGCCATCCAAGACGCCGGGATCTTCTCATGGGACCTCGGATTGACCTTGATCAACTTCGTGACGCCTAGCAGGAAGGTGGACCATGTCACCCCC
GCGGGCCATCCTGGCGCAGGTGGGACGTGGCCTGAGTATATCCCACCGACGGAGGGAGATAGTCGGTGCTCGTGTCCTGCGTTGAACGCTATGGCGAATCATG
TGGTGTGTCTGTCCATT
TGTCGATTGCGATGTTGCCGACCTGCTTGAATGAATTTTTGACAGGCATCCTACCCCGCGATGGGAAAAACATCTCCTTCCCAGAGATGAACAGCACGATTAGGGCAACTTACAACTTTG
CACCGTCTTTCTGCTTCTTCGTCCCAAACTTTGCTGCTAGGATGTTGAACAAGAGTTACGGGAAAGATAGATTTGACTTGGCTGATTTGGATTTACACAATGGGATTGAACACGATGCGT
CTCTCACTC
TCGTGAGCTCTCTTGTTTCTTTCCCTTCGATGTCGTAATAAACGACAGCTTAAATTGAACAGGCGAAGACCTTCATTTCGTCAAAGATCAAGGGAAGCCGCACCTTCCTTT
CGTAAGAGAACTCCTCGATTCTGCATCGGGGAAGGACAAAGATGGAAACGTACTCCTCACCCCGGCCGACCTTTCTCGTTATTCCGCCAAGCGTCGCGCAGAGTCTCGTGCCAACAACCC
CGAGTTTTCTTTAGACCTGTTCCACAAGATGTTTGGTAGCTCCAA
AAGTACGTTTTCTCATCCCCCCTCCCTCCTCTCTCTTTTATCTCAACCTTCTTATACAGCTCCTCAACTCTCTTG
ACGGTATTCGGCGGACGCGTTTCCGATCTCGAGTCCATCCTCATCGATGAGCGTTTTCCTGAAGGGTGGGAGTCGAGAGTCAGGGAGCCCTTTGGGTTGACGATAGCGTCTTTCCAACCG
ACTGTTCTGAAGGTGGAATTTGGGATTGATGAGAGCAAATATGCCGCGGAGGCTAGCTCGACTGCAGCTGTTGAGAGTGGGGAACCAAATCCAGCAGCGTAG

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGTTCCTCGTAACCCCAATCGCCCGAGCCATCCAAGACGCCGGGATCTTCTCATGGGACCTCGGATTGACCTTGATCAACTTCGTGACGCCTAGCAGGAAGGTGGACCATGTCACCCCC
GCGGGCCATCCTGGCGCAGGTGGGACGTGGCCTGAGTATATCCCACCGACGGAGGGAGATAGTCGGTGCTCGTGTCCTGCGTTGAACGCTATGGCGAATCATG
GCATCCTACCCCGCGAT
GGGAAAAACATCTCCTTCCCAGAGATGAACAGCACGATTAGGGCAACTTACAACTTTGCACCGTCTTTCTGCTTCTTCGTCCCAAACTTTGCTGCTAGGATGTTGAACAAGAGTTACGGG
AAAGATAGATTTGACTTGGCTGATTTGGATTTACACAATGGGATTGAACACGATGCGTCTCTCACTC
GCGAAGACCTTCATTTCGTCAAAGATCAAGGGAAGCCGCACCTTCCTTTCGTA
AGAGAACTCCTCGATTCTGCATCGGGGAAGGACAAAGATGGAAACGTACTCCTCACCCCGGCCGACCTTTCTCGTTATTCCGCCAAGCGTCGCGCAGAGTCTCGTGCCAACAACCCCGAG
TTTTCTTTAGACCTGTTCCACAAGATGTTTGGTAGCTCCAA
CTCCTCAACTCTCTTGACGGTATTCGGCGGACGCGTTTCCGATCTCGAGTCCATCCTCATCGATGAGCGTTTTCCTGAA
GGGTGGGAGTCGAGAGTCAGGGAGCCCTTTGGGTTGACGATAGCGTCTTTCCAACCGACTGTTCTGAAGGTGGAATTTGGGATTGATGAGAGCAAATATGCCGCGGAGGCTAGCTCGACT
GCAGCTGTTGAGAGTGGGGAACCAAATCCAGCAGCGTAG

Retrieve as FASTA