1. Browse the Database
  2. View Redoxidase
Entry information : CcinHalPrx01
Entry ID 6518
Creation 2009-01-24 (Christophe Dunand)
Last sequence changes 2009-01-24 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2010-08-13 (Christophe Dunand)
Peroxidase information: CcinHalPrx01
Name CcinHalPrx01
Class Haloperoxidase (haem)    [Orthogroup: HalPrx001]
Taxonomy Eukaryota Fungi Basidiomycota Agaricomycetes Psathyrellaceae Coprinopsis
Organism Coprinopsis cinerea (Coprinus cinereus)    [TaxId: 5346 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value CcinHalPrx01
start..stop		 S start..stop
CcinHalPrx02 538 0 1..271 1..272
LbiHalPrx01 388 5.15e-137 3..281 7..284
AbHalPrx01_bisporus 365 7.29e-128 13..281 14..282
LbiHalPrx02 340 7.05e-118 12..270 16..275
Gene structure Fichier Exons►


exon

Literature and cross-references CcinHalPrx01
Literature Tsang,A., Storms,R. and Butler,G. Expressed sequence tags from Coprinus cinereus cDNA library.
DNA ref. JGI genome:   Chr_6 (1287837..1286730)
EST ref. GenBank:   DY848129.1 [5' end]  DY850806.1 [3' end]
Protein sequence: CcinHalPrx01
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   304
PWM (Da):   %s   32929.51  
PI (pH):   %s   5.26
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MGVTGKIRSMRAVAWDVGCTVANLVWPNRKPGSVTPAGCPGAGGKWPEFVPPKEGDSRCSCPALNAMANHGLLPHDGKNIKFSELGDKIRETYNFAPSFCLFVPNYAATMLGKDFNKDTF
DLQELDLHNGIEHDASLTREDAALVPDQSKPHIPFIRELLDSATGTDAEGRKLLTIEDLSKYSAKRRVDARETNPEYTLSKVHRTFGSANSSTLLTIFGGRVDDLESILIDERIPDGWES
RILEEFGLTIITFNLKTVHKVEGGIDEEKYIAERKATAAAQGNAEGESSSVAKSDSANPSPTGS

Retrieve as FASTA  
Remarks Complete sequence from genomic (chromo 6, 3 introns) and 5 ESTs.
DNA ►
Send to BLAST
CDS►
Send to BLAST