Entry information : CcinHalPrx03
Entry ID 6519
Creation 2009-01-24 (Christophe Dunand)
Last sequence changes 2010-08-13 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2010-08-13 (Christophe Dunand)
Peroxidase information: CcinHalPrx03
Name CcinHalPrx03
Class Haloperoxidase (haem)    [Orthogroup: HalPrx001]
Taxonomy Eukaryota Fungi Basidiomycota Agaricomycetes Psathyrellaceae Coprinopsis
Organism Coprinopsis cinerea (Coprinus cinereus)    [TaxId: 5346 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value CcinHalPrx03
start..stop
S start..stop
AbHalPrx02_bisporus 298 3e-102 1..260 6..263
LbiHalPrx04 294 3e-101 1..263 1..250
SlutHalPrx03 207 5e-67 1..266 1..249
SbreHalPrx03 194 1e-61 13..260 17..250
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 183524..183681 158 N° 2 182817..183470 654  
complement(join(182817..183470,183524..183681))


exon

Literature and cross-references CcinHalPrx03
DNA ref. JGI genome:   Chr_5 (183681..182817)
EST ref. GenBank:   DY851188.1 [5' end]
Protein sequence: CcinHalPrx03
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   269
PWM (Da):   %s   29594.16  
PI (pH):   %s   8.01
Sequence 310
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MSDSSSLSSHGPHAHSPAGCPVTGSAHGYCPAQKGDSRSPCPALNTMANHGYINRDGKNLSAWSIAKGLRECYGLTMPFSIFLSYTTFLLLRKFRPIDLYEIGKHGVVEHNASLVHHDTPPGQIYAPIEIDQGLVEAVVKDAQTVVEAEVEVDGVKQKKTETLYSIFDMGRSRVRREKESPPLTSVQAKIARGELAIIQAVWEKKVGEKVGSPIEWIKRWLGEERLPDGWKPDREVGFVATNTRNKAIQKAMEEIRKQEAEAADPKAKL

Retrieve as FASTA  
Remarks Complete sequence from genomic (chromo 5, 1 intron) and 2 ESTs. Strain="okayama7#130".
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGTCTGACAGCTCTTCTCTATCGTCTCATGGGCCTCATGCCCACAGTCCTGCGGGATGTCCTGTCACTGGGAGTGCGCATGGCTATTGCCCTGCACAGAAGGGCGACTCACGTTCACCC
TGTCCTGCCTTAAATACCATGGCAAACCATGGCTACAT
GTGAGTCTATATTCGTATTCGCATTGAATGACATTCTCTGACGCAGCTTTTAGTAATCGAGACGGCAAAAACTTGAGCGCTT
GGTCAATAGCCAAGGGCCTACGTGAATGTTATGGCCTAACAATGCCATTCTCCATCTTCCTCTCCTACACGACATTCCTTCTCCTTCGTAAATTCCGCCCGATCGACCTCTACGAGATTG
GAAAGCATGGGGTGGTGGAGCATAACGCCAGCCTCGTGCACCACGACACGCCACCCGGCCAGATATACGCACCTATCGAAATCGACCAGGGACTTGTGGAAGCAGTCGTCAAGGATGCTC
AGACGGTCGTCGAAGCCGAGGTCGAAGTTGACGGCGTAAAGCAGAAGAAGACGGAAACCCTCTACAGCATATTCGACATGGGAAGGTCCCGCGTGCGGAGAGAGAAAGAATCGCCTCCTC
TCACATCTGTTCAGGCGAAGATAGCTCGTGGAGAGCTTGCGATCATCCAAGCCGTGTGGGAGAAGAAGGTTGGAGAGAAGGTCGGCTCGCCTATCGAGTGGATTAAGAGGTGGTTGGGGG
AAGAACGCTTGCCCGATGGATGGAAGCCGGACAGAGAAGTCGGCTTTGTTGCCACCAACACCCGTAACAAGGCTATCCAAAAAGCCATGGAGGAGATTCGAAAGCAGGAGGCTGAGGCCG
CTGATCCAAAAGCTAAACTATAAG

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGTCTGACAGCTCTTCTCTATCGTCTCATGGGCCTCATGCCCACAGTCCTGCGGGATGTCCTGTCACTGGGAGTGCGCATGGCTATTGCCCTGCACAGAAGGGCGACTCACGTTCACCC
TGTCCTGCCTTAAATACCATGGCAAACCATGGCTACAT
TAATCGAGACGGCAAAAACTTGAGCGCTTGGTCAATAGCCAAGGGCCTACGTGAATGTTATGGCCTAACAATGCCATTCTCC
ATCTTCCTCTCCTACACGACATTCCTTCTCCTTCGTAAATTCCGCCCGATCGACCTCTACGAGATTGGAAAGCATGGGGTGGTGGAGCATAACGCCAGCCTCGTGCACCACGACACGCCA
CCCGGCCAGATATACGCACCTATCGAAATCGACCAGGGACTTGTGGAAGCAGTCGTCAAGGATGCTCAGACGGTCGTCGAAGCCGAGGTCGAAGTTGACGGCGTAAAGCAGAAGAAGACG
GAAACCCTCTACAGCATATTCGACATGGGAAGGTCCCGCGTGCGGAGAGAGAAAGAATCGCCTCCTCTCACATCTGTTCAGGCGAAGATAGCTCGTGGAGAGCTTGCGATCATCCAAGCC
GTGTGGGAGAAGAAGGTTGGAGAGAAGGTCGGCTCGCCTATCGAGTGGATTAAGAGGTGGTTGGGGGAAGAACGCTTGCCCGATGGATGGAAGCCGGACAGAGAAGTCGGCTTTGTTGCC
ACCAACACCCGTAACAAGGCTATCCAAAAAGCCATGGAGGAGATTCGAAAGCAGGAGGCTGAGGCCGCTGATCCAAAAGCTAAACTATAAG

Retrieve as FASTA