1. Browse the Database
  2. View Redoxidase
Entry information : CcinPrxQ
Entry ID 6524
Creation 2009-01-24 (Christophe Dunand)
Last sequence changes 2009-01-24 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2010-08-13 (Marie Brette (Scipio))
Peroxidase information: CcinPrxQ
Name CcinPrxQ
Class Atypical 2-Cysteine peroxiredoxin (type Q)    [Orthogroup: PrxQ001]
Taxonomy Eukaryota Fungi Basidiomycota Agaricomycetes Psathyrellaceae Coprinopsis
Organism Coprinopsis cinerea (Coprinus cinereus)    [TaxId: 5346 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value CcinPrxQ
start..stop		 S start..stop
LbiPrxQ02 301 5.79e-105 1..229 1..226
PplPrxQ02 283 1.02e-97 1..230 1..228
AmusPrxQ 276 2.11e-94 2..227 3..247
AbPrxQ_bisporus 275 3.75e-94 17..226 22..243
Gene structure Fichier Exons►


exon

Literature and cross-references CcinPrxQ
Literature Tsang,A., Storms,R. and Butler,G. Expressed sequence tags from Coprinus cinereus cDNA library.
DNA ref. JGI genome:   Chr_12 (1712755..1711705)
mRNA ref. GenBank:   XM_001835149
EST ref. GenBank:   DY850209.1
Cluster/Prediction ref. Genebank:   6011799
Protein sequence: CcinPrxQ
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   233 (327)
PWM (Da):   %s   24720.73 (34215.2)  
PI (pH):   %s   8.8 (5.88) Peptide Signal:   %s   cut: 23 range:23-349
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MPARAKSSEGAASAEPPRRSSRIAAQPQPDPPAPKPQRKASSSKK
RAAEEPAAEEKSAESSSKKAKSDSDEAGNGDEAASLQPIDIGDSLPSLVLKNEKGEDIQIADLAKEKGVVLFLVPRADTPGCTTQACGFRDIYPDFSSVNFDVYCLSADSPTAQTKWQTKELPYSLISDPKRSLIAALG
ASEGGKTKRSHFIFEKGGKLVEKRNPVKPGESPQLALEFIKGLESKAE

Retrieve as FASTA  
Remarks Complete sequence from genomic (4 introns) and 6 ESTs.
DNA ►
Send to BLAST
CDS►
Send to BLAST