Entry information : CcinKat04
Entry ID 6532
Creation 2009-01-26 (Christophe Dunand)
Last sequence changes 2009-01-26 (Christophe Dunand)
Sequence status complete
Reviewer Marcel Zamocky
Last annotation changes 2011-06-17 (Marcel Zamocky)
Peroxidase information: CcinKat04
Name CcinKat04
Class Catalase    [Orthogroup: Kat002]
Taxonomy Eukaryota Fungi Basidiomycota Agaricomycetes Psathyrellaceae Coprinopsis
Organism Coprinopsis cinerea (Coprinus cinereus)    [TaxId: 5346 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value CcinKat04
start..stop
S start..stop
CcinKat03 1067 0 1..578 1..576
CtheKat3 813 0 1..578 14..582
PnoKat01 810 0 26..561 3..530
SAcoKat02 806 0 2..570 10..574
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 2366887..2367175 289 N° 2 2367236..2367309 74 N° 3 2367376..2367537 162 N° 4 2367592..2367806 215
N° 5 2367860..2368856 997  
join(2366887..2367175,2367236..2367309,2367376..2367537,2367592..2367806,2367860 ..2368856)


exon

Literature and cross-references CcinKat04
DNA ref. JGI genome:   Chr_9 (2366887..2368853)
Protein sequence: CcinKat04
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   578
PWM (Da):   %s   65218.06  
PI (pH):   %s   7.35
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MQAAKEALGAVGVDPRPVQRSSTFMNANEGPAEIISKVSGVVGAGKRQDDAPYFTNNEGIPWPDGTHSKNVGGIPVASDIFLMQKQQTFNRSKTLERMVHPSGSGAFGYFECTNDMSELTAGLFSKAGKKTPIFLRFSTVTFGREFPDSGRNPRGFAIKHYTEEGNYDVVGLNWPIFFCRDPMQGPDVIRSQQRNPQNFMLDYDSTFDFLANTPEANHAGMMFFSDHGTPKGWRNNHGYGCHTFKWVNAEGKFVYVKYHYLAELGQKQFTWPEAVAMSGEDPDFSKRDLWAAIERGETPTWTMKVQIMRPEEADPNKLGFDPFDVTKVWPRGQFPMHEVGKLVLNKNPENYHRDVEQAAFSPGSMVPGIEDSPDSLLQFRMFFYRDAQYHRLGVNLHQVPVNCPFMAKSYSSLNFDGPLRSDANTGLNPHYTPNSFVNKFRPDDAEVPYQVADNVVSRQSHFWHEGKLSDYDQARELYTRVMDEKARQHLHYNTAVALKLVNYKVVKVNYLAQQYRISPDYAKAIYDLLPKSAQDFSFDEVVAKSKVAPILTKEEKFAPTQSHHRSLGVPAGGLAYN

Retrieve as FASTA  
Remarks Complete sequence from genomic (4 introns). No EST.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGCAAGCTGCTAAAGAAGCGCTCGGCGCCGTCGGCGTCGATCCCCGCCCCGTCCAGCGCTCTTCCACGTTCATGAACGCCAACGAAGGCCCCGCCGAGATCATCTCCAAGGTTTCAGGT
GTCGTTGGGGCTGGGAAGAGGCAGGACGACGCGCCATACTTTACGAACAACGAGGGCATTCCGTGGCCTGATGGAACCCACAGCAAGAATGTTGGAGGAATCCCGGTGGCGAGCGATATC
TTTTTGATGCAGAAGCAGCAGACTTTTAATCGGAGCAAGACTTTGGAAC
GTACGTCTTCTTTCCTGAACTTGATGGTCGTGCATTAGCTGATGGTACGTCGTGTTTTAGGTATGGTTCAT
CCCTCTGGGTCCGGCGCCTTCGGGTACTTTGAATGTACCAACGATATGAGTGAGCTCACCAAG
GTGCGTTCTGTCTGGGGTTTCGACGTTGGGCCAGTCTGGGCTGATACACATTTCAAA
CGCGACTAGGCTGGGCTCTTCAGCAAGGCGGGGAAGAAGACACCCATTTTCCTTCGTTTTTCGACCGTCACCTTTGGACGCGAATTTCCCGACTCGGGACGTAACCCTCGTGGCTTCGCC
ATCAAGCACTACACCGAGGAAGGCAATTATGATGTTGTCGGTTTGAACTGG
GTACGTTTGCTGCTACCATCGCGTGCATTGTCCCCCGAGCTGACGTGTTTCTAGCCTATCTTCTTTTGC
CGCGACCCCATGCAAGGCCCCGACGTCATTCGCTCCCAGCAACGTAACCCACAGAACTTCATGCTGGACTATGATAGCACCTTCGACTTCCTCGCCAACACTCCTGAAGCCAACCACGCT
GGGATGATGTTTTTCAGCGATCATGGTACACCCAAGGGATGGAGGAACAACCACGGCTATGGGTGCCATACGTTCAAATG
GTGCCCTTTGTCAATATTTTTGCTTCACGGTCACCCTAAC
ACTTTCTCCCTAGGGTCAATGCCGAGGGCAAATTTGTTTATGTCAAGTACCACTACCTCGCCGAGCTGGGCCAGAAGCAGTTCACCTGGCCTGAAGCTGTTGCGATGAGTGGCGAAGACC
CGGATTTCTCCAAGCGCGACTTGTGGGCTGCTATTGAACGTGGCGAGACACCTACTTGGACCATGAAGGTTCAGATCATGCGCCCTGAAGAAGCTGATCCCAACAAGCTTGGCTTCGACC
CCTTCGACGTTACCAAAGTCTGGCCTCGAGGCCAATTCCCCATGCACGAAGTTGGAAAACTCGTCCTCAACAAGAACCCCGAGAATTACCATCGTGACGTGGAGCAAGCTGCTTTCTCGC
CTGGCTCCATGGTTCCTGGTATCGAAGACTCTCCCGACAGTCTCCTCCAATTCCGCATGTTCTTCTACCGTGATGCGCAGTACCACCGACTTGGTGTTAACCTTCACCAAGTCCCAGTGA
ACTGTCCATTCATGGCGAAAAGTTACTCCTCCCTCAACTTTGACGGTCCGTTGCGTAGCGACGCTAACACCGGCCTCAACCCCCACTACACTCCCAACTCCTTCGTGAACAAGTTCCGTC
CTGACGATGCCGAGGTGCCCTACCAGGTTGCCGACAACGTCGTCTCGCGCCAGTCCCACTTTTGGCACGAGGGCAAGCTCTCCGACTACGACCAGGCCCGCGAGCTTTACACACGCGTCA
TGGACGAGAAGGCGCGCCAGCACCTCCACTACAACACCGCAGTCGCATTGAAGCTTGTCAACTACAAGGTTGTCAAGGTCAATTATCTTGCTCAGCAGTATCGCATTTCGCCCGATTATG
CCAAGGCGATCTACGATTTGTTGCCCAAGAGCGCACAGGACTTTTCGTTCGACGAGGTGGTGGCCAAGTCCAAGGTTGCTCCGATTTTGACCAAGGAGGAGAAGTTTGCGCCGACTCAGA
GCCATCATCGTTCTCTTGGTGTCCCAGCCGGTGGTTTGGCATATAACTAG

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGCAAGCTGCTAAAGAAGCGCTCGGCGCCGTCGGCGTCGATCCCCGCCCCGTCCAGCGCTCTTCCACGTTCATGAACGCCAACGAAGGCCCCGCCGAGATCATCTCCAAGGTTTCAGGT
GTCGTTGGGGCTGGGAAGAGGCAGGACGACGCGCCATACTTTACGAACAACGAGGGCATTCCGTGGCCTGATGGAACCCACAGCAAGAATGTTGGAGGAATCCCGGTGGCGAGCGATATC
TTTTTGATGCAGAAGCAGCAGACTTTTAATCGGAGCAAGACTTTGGAAC
GTATGGTTCATCCCTCTGGGTCCGGCGCCTTCGGGTACTTTGAATGTACCAACGATATGAGTGAGCTCACC
AAG
GCTGGGCTCTTCAGCAAGGCGGGGAAGAAGACACCCATTTTCCTTCGTTTTTCGACCGTCACCTTTGGACGCGAATTTCCCGACTCGGGACGTAACCCTCGTGGCTTCGCCATCAAG
CACTACACCGAGGAAGGCAATTATGATGTTGTCGGTTTGAACTGG
CCTATCTTCTTTTGCCGCGACCCCATGCAAGGCCCCGACGTCATTCGCTCCCAGCAACGTAACCCACAGAACTTC
ATGCTGGACTATGATAGCACCTTCGACTTCCTCGCCAACACTCCTGAAGCCAACCACGCTGGGATGATGTTTTTCAGCGATCATGGTACACCCAAGGGATGGAGGAACAACCACGGCTAT
GGGTGCCATACGTTCAAATG
GGTCAATGCCGAGGGCAAATTTGTTTATGTCAAGTACCACTACCTCGCCGAGCTGGGCCAGAAGCAGTTCACCTGGCCTGAAGCTGTTGCGATGAGTGGC
GAAGACCCGGATTTCTCCAAGCGCGACTTGTGGGCTGCTATTGAACGTGGCGAGACACCTACTTGGACCATGAAGGTTCAGATCATGCGCCCTGAAGAAGCTGATCCCAACAAGCTTGGC
TTCGACCCCTTCGACGTTACCAAAGTCTGGCCTCGAGGCCAATTCCCCATGCACGAAGTTGGAAAACTCGTCCTCAACAAGAACCCCGAGAATTACCATCGTGACGTGGAGCAAGCTGCT
TTCTCGCCTGGCTCCATGGTTCCTGGTATCGAAGACTCTCCCGACAGTCTCCTCCAATTCCGCATGTTCTTCTACCGTGATGCGCAGTACCACCGACTTGGTGTTAACCTTCACCAAGTC
CCAGTGAACTGTCCATTCATGGCGAAAAGTTACTCCTCCCTCAACTTTGACGGTCCGTTGCGTAGCGACGCTAACACCGGCCTCAACCCCCACTACACTCCCAACTCCTTCGTGAACAAG
TTCCGTCCTGACGATGCCGAGGTGCCCTACCAGGTTGCCGACAACGTCGTCTCGCGCCAGTCCCACTTTTGGCACGAGGGCAAGCTCTCCGACTACGACCAGGCCCGCGAGCTTTACACA
CGCGTCATGGACGAGAAGGCGCGCCAGCACCTCCACTACAACACCGCAGTCGCATTGAAGCTTGTCAACTACAAGGTTGTCAAGGTCAATTATCTTGCTCAGCAGTATCGCATTTCGCCC
GATTATGCCAAGGCGATCTACGATTTGTTGCCCAAGAGCGCACAGGACTTTTCGTTCGACGAGGTGGTGGCCAAGTCCAAGGTTGCTCCGATTTTGACCAAGGAGGAGAAGTTTGCGCCG
ACTCAGAGCCATCATCGTTCTCTTGGTGTCCCAGCCGGTGGTTTGGCATATAACTAG

Retrieve as FASTA