Entry information : LbiPrxII
Entry ID 6554
Creation 2009-01-30 (Christophe Dunand)
Last sequence changes 2009-01-30 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2012-04-06 (Catherine Mathe (Scipio))
Peroxidase information: LbiPrxII
Name LbiPrxII
Class Atypical 2-Cysteine peroxiredoxin (type II)    [Orthogroup: PrxII001]
Taxonomy Eukaryota Fungi Basidiomycota Agaricomycetes Tricholomataceae Laccaria
Organism Laccaria bicolor    [TaxId: 29883 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value LbiPrxII
start..stop
S start..stop
AthiPrxII 267 3.79e-93 3..169 6..172
CcinPrxII 254 2.96e-88 2..169 4..171
SlutPrxII01 251 6.8e-87 1..169 4..172
SbrePrxII01 247 2.2e-85 1..169 4..172
Gene structure Fichierperl './assets/cgi-bin/draw_exon.pl' '6554' 'join(10029115..10029192,10029248..10029263,10029316..10029386,10029450..10029596,10029658..10029795,10029842..10029901)' Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 10029115..10029192 76 N° 2 10029248..10029263 14 N° 3 10029316..10029386 69 N° 4 10029450..10029596 145
N° 5 10029658..10029795 136 N° 6 10029842..10029901 58  
join(10029115..10029192,10029248..10029263,10029316..10029386,10029450..10029596 ,10029658..10029795,10029842..10029901)


exon

Literature and cross-references LbiPrxII
Literature Martin et al., The genome of Laccaria bicolor provides insights into mycorrhizal symbiosis. Nature 452 (7183), 88-92 (2008).
DNA ref. JGI genome:   LG_1 (10029115..10029901)
Protein sequence: LbiPrxII
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   169
PWM (Da):   %s   17882.22  
PI (pH):   %s   5.19
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MSLKVGDTIPEGSFKYIPYTSELEDSLACGIPTALSTNEWKGKKVVLFSVPGAFPTCHANHLPGYLQNYDAFKAKGVDVIAVVAANDAFVMSGWGRFEGVKDKILTLTDTDAKWSASLGL
DKDLSAAGLGHRTWRFAIVIDDLVVKYIG
VEPGPGVTVSGASEVLAKL*

Retrieve as FASTA  
Remarks Complete sequence from genomic (5 introns).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGTCTCTCAAAGTTGGTGATACAATCCCAGAGGGTAGCTTCAAGTACATTCCGTACACCTCTGAGCTCGAGGACAGCGCGTGAGCACATCCAAAGACCCCTAATATCCCTGTGTCCGAC
TTAATCAAACTGTAGCTTGCTTGTGGTATTCTCGTACGTGCAGGCACAGATCATCATTGACTCGAGGCATAACTTATCAATACAGCTACCGCTCTGTCAACCAACGAATGGAAGGGCAAG
AAAGTCGTCCTGTTCTCCGTACCCGGAGCGTTCACT
CTGTAAGCATGGTTGATATACCAATCAGAACCAATCATCTAATCGCCGCAATCTATCACTTCTAGCCCACCTGCCACGCCAACC
ACTTGCCTGGTTATCTTCAGAACTACGATGCGTTCAAAGCGAAGGGTGTTGATGTAATCGCTGTTGTTGCTGCCAATGACGCCTTCGTCATGAGCGGCTGGGGCCGATTTGAAGGTGTCA
AGGATAAA
AAGTACATTTTCAAGTTTATCTACTCACTCCGATCAATGTTGAGCAACGGCCATCTTCGTCAGATCCTTACGCTCACTGACACCGACGCAAAGTGGTCTGCTAGTCTTGGTC
TTGACAAGGACTTGAGTGCTGCCGGTCTTGGCCATCGCACCTGGCGATTCGCCATTGTCATTGACGACCTCGTCGTCAAGTACATTGGA
GAGTACGTGATTGTTTGTTTTGCGCGGCTTT
TGCTGACCCTTGCATAGGTCGAGCCTGGCCCCGGTGTAACTGTCTCTGGCGCTTCCGAAGTCCTCGCCAAATTATAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGTCTCTCAAAGTTGGTGATACAATCCCAGAGGGTAGCTTCAAGTACATTCCGTACACCTCTGAGCTCGAGGACAGCCTTGCTTGTGGTATTCCTACCGCTCTGTCAACCAACGAATGG
AAGGGCAAGAAAGTCGTCCTGTTCTCCGTACCCGGAGCGTTCACT
CCCACCTGCCACGCCAACCACTTGCCTGGTTATCTTCAGAACTACGATGCGTTCAAAGCGAAGGGTGTTGATGTA
ATCGCTGTTGTTGCTGCCAATGACGCCTTCGTCATGAGCGGCTGGGGCCGATTTGAAGGTGTCAAGGATAAA
ATCCTTACGCTCACTGACACCGACGCAAAGTGGTCTGCTAGTCTTGGT
CTTGACAAGGACTTGAGTGCTGCCGGTCTTGGCCATCGCACCTGGCGATTCGCCATTGTCATTGACGACCTCGTCGTCAAGTACATTGGA
GTCGAGCCTGGCCCCGGTGTAACTGTCTCT
GGCGCTTCCGAAGTCCTCGCCAAATTATAA

Retrieve as FASTA