Entry information : CcinPrxQ01
Entry ID 6556
Creation 2009-01-30 (Christophe Dunand)
Last sequence changes 2009-01-30 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2010-08-13 (Marie Brette (Scipio))
Peroxidase information: CcinPrxQ01
Name CcinPrxQ01
Class Atypical 2-Cysteine peroxiredoxin (type Q)    [Orthogroup: PrxQ001]
Taxonomy Eukaryota Fungi Basidiomycota Agaricomycetes Psathyrellaceae Coprinopsis
Organism Coprinopsis cinerea (Coprinus cinereus)    [TaxId: 5346 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value CcinPrxQ01
start..stop
S start..stop
LbiPrxQ01 216 7.58e-73 3..159 2..158
HcyPrxQ 213 4.58e-71 4..173 3..172
PcPrxQ 187 8.65e-61 7..167 7..166
PcarPrxQ01 186 1.69e-60 7..167 7..166
Gene structure Fichier Exons


exon

Literature and cross-references CcinPrxQ01
Literature Birren et al., The Broad Institute Genome Sequencing Platform. Annotation of the Coprinopsis cinerea genome.
DNA ref. JGI genome:   Chr_8 (1698499..1697622)
mRNA ref. GenBank:   XM_001835921.1
Cluster/Prediction ref. Genebank:   6012513
Protein sequence: CcinPrxQ01
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   176
PWM (Da):   %s   19017.69  
PI (pH):   %s   7.51
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MSTFADLIGKEAPAFSLPNHDGDTFEFKPGASGRPTAILFYPESGSYGCTQQICQFRDAVVDKVNFNPDRVQIIGISANTVEKQKGFVEKHSLFPILSDVKKEAVAKYRVPRGMAGLVPV
ARVTFVIDSKGVV
RDALDTTMNYGAHQGFVEKWLTKLEGEESKSGATARETTAAS

Retrieve as FASTA  
Remarks Complete sequence from genomic (4 introns)
DNA
Send to BLAST
CDS
Send to BLAST