Entry information : PtroGPx06
Entry ID 6574
Creation 2009-02-05 (Christophe Dunand)
Last sequence changes 2010-11-23 (Myriam Duval)
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2010-12-28 (Christophe Dunand)
Peroxidase information: PtroGPx06
Name PtroGPx06
Class Animal glutathione peroxidase    [Orthogroup: Gpx1006]
Taxonomy Eukaryota Metazoa Chordata Mammalia Hominidae Pan
Organism Pan troglodytes (chimpanzee)    [TaxId: 9598 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value PtroGPx06
start..stop
S start..stop
HsGPx06 441 2.28e-160 1..221 1..221
MmulGPx06 432 9.65e-157 1..221 1..221
BtGPx06 380 2.2e-136 1..220 1..220
RnoGPx06 345 2.36e-122 1..221 1..221
Gene structure Fichier Exons


exon

Literature and cross-references PtroGPx06
DNA ref. GenBank:   NC_006473.2 (29028015..29016597)
Protein sequence: PtroGPx06
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   221 (200)
PWM (Da):   %s   24669.53 (22242.3)  
PI (pH):   %s   6.75 (6.26) Peptide Signal:   %s   cut: 22 range:22-221
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MFRQFQASCLVLLFLVGFAQQILKPQNRKVDCNKGVTGTIYEYGALTLNGEEYIQFKQFAGKHVLFVNVATYUGLAAQYPELNALQEELKNFGVIVLAFPCNQFGKQEPGTNSEILLGLK
YVCPGSGFVPSFQLFEKGDVNGEKEQKVFTFLKNSCPPTSDLLGSSSQLFWEPMKVHDICWNFEKFLVGPDGVPVMRWFHQAPVSTVKSDILEYLKQFNTH

Retrieve as FASTA  
Remarks Complete sequence from genomic (chromo 6, 4 introns). No EST.
DNA
Send to BLAST
CDS
Send to BLAST