Entry information : PblKat01
Entry ID 6598
Creation 2009-02-19 (Christophe Dunand)
Last sequence changes 2009-02-19 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2012-05-07 (Catherine Mathe (Scipio))
Peroxidase information: PblKat01
Name PblKat01
Class Catalase    [Orthogroup: Kat001]
Taxonomy Eukaryota Fungi Mucoraceae Phycomyces
Organism Phycomyces blakesleeanus    [TaxId: 4837 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value PblKat01
start..stop
S start..stop
RoKat01 825 0 1..484 1..484
CowKat01 691 0 6..478 4..477
PpalKat01 651 0 1..477 1..480
DpuKat01 647 0 1..477 1..480
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 67778..67863 86 N° 2 67687..67721 35 N° 3 67562..67633 72 N° 4 67341..67505 165
N° 5 67225..67290 66 N° 6 66737..67167 431 N° 7 66423..66681 259 N° 8 65968..66308 341
complement(join(65968..66308,66423..66681,66737..67167,67225..67290,67341..67505 ,67562..67633,67687..67721,67778..67863))


exon

Literature and cross-references PblKat01
DNA ref. JGI genome:   scaffold_29 (67863..65968)
mRNA ref. JGI transcript:   24108
EST ref. GenBank:   EX810103.1 [5' end]   EX810102.1 [3' end]
Protein sequence: PblKat01
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   484
PWM (Da):   %s   54449.15  
PI (pH):   %s   7.41
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MSKNILTTSNGNPVENDQTSQTAGPTGPVLIQDFHLIDKAHFDRERIPERVVHAKGAGAHGYFEVTHDISKLTKAKFLNGIGKKTPIFTRFSTVGGAQGSADTARDPRGFAVKFYTEEGNWDMVGNNTPVFFIRDPSKFPDFIHTQKKNPRTNLPDADMFWDFLSLVPESIHQVSILFSNRGTPDGFRHMHGFSSHTLKLVDDKGQFKYVKWHFKTDQGVKNLSASEAARISGIDPDYSTRDLFNAIERGEHPSWSVYIQIMEPNDAKSYRFDPFDITKVWPHDYPLVPVGKMVLNRNPENYFAETEQAAFSPSHMVPGIDVSPDRMLQGRLFSYPDTHRHRLGPNYTQIPINQPVSRVANYQRDGFMTVNGNGGSNLNYGPNSFDGPYQNDIVGSTYTAEEISGFTGRFTYELKDVDFVQAGDLYRVMSPEERTDLVNNIAGHLKNAKKHIRDRQIAHFKRADREYGSRIESAILGLTAKA

Retrieve as FASTA  
Remarks Complete sequence from genomic (7 introns) and 2 ESTs.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGTCCAAGAACATCTTAACAACTTCCAATGGAAACCCCGTTGAGAATGATCAAACCTCTCAGACTGCTGGTCCCACAGGCCCAGTGTAAGCTCGGTATCAGCATAAATTTTATCAGTTT
CTAATATACAACCTCTTTATAGTCTTATCCAGGACTTCCACTTGATTGACAAACTTGGTATGTATTTACGATTAGCACACTTCAAACAAACTCTAATACATTCAATGTAGCCCATTTTGA
CAGAGAACGCATCCCTGAACGCGTCGTTCATGCCAAAGGAGCTGGAGCACACGGCTATTTCG
GTAAACAATAAATGCATTTTCAATATATATGTATATAGATACTTATAATTATATAGAG
GTTACCCACGATATTTCCAAGCTGACAAAAGCCAAGTTCTTGAATGGAATTGGCAAAAAGACACCCATATTTACCCGTTTTTCTACCGTCGGTGGTGCCCAAGGAAGTGCGGACACAGCC
CGCGACCCTCGTGGATTTGCTGTCAAGTTCTACACAGAAGAAG
GTAAATAGATAAACCCTAGCCTTTTTTTAAATACTAATATCTGTTTGTAGGTAACTGGGATATGGTTGGTAACAACA
CCCCAGTCTTCTTCATCCGCGATCCATCGAAATTCCCTG
GTAAGTTAGTACACAAAGCAACCGTGGGCTCAAATTAACCCAAGTTGACCAATATAGATTTTATCCACACTCAGAAGAAGA
ATCCAAGAACCAATCTTCCTGATGCTGATATGTTCTGGGACTTCTTATCACTTGTCCCAGAGTCTATCCACCAAGTGTCCATTCTCTTCTCTAACCGCGGCACTCCAGATGGATTCCGTC
ACATGCACGGCTTCTCTTCTCACACTCTTAAGCTAGTTGATGACAAGGGGCAGTTCAAGTATGTCAAATGGCACTTCAAGACTGACCAGGGAGTCAAGAACCTGTCGGCCAGTGAAGCTG
CTAGAATTTCCGGTATCGATCCTGATTACTCTACACGCGATCTCTTCAACGCAATTGAACGCGGCGAACATCCTTCGTGGTCCGTCTATATTCAAATCATGGAACCTAATGACGCAAAGA
GCTACCGCTTTGATCCATTTGATATCACCAAAGTCTGGCCCCATAGT
GTAATATCAACTTTAATATTTGTCCAAAACAATTTATTCTAACCTCTCACTATAGGATTACCCTCTTGTTCCC
GTTGGTAAGATGGTCTTGAACAGAAACCCTGAAAACTACTTTGCGGAGACGGAGCAAGCTGCGTTTAGTCCTTCGCACATGGTTCCTGGTATCGATGTCAGCCCCGACCGTATGCTGCAG
GGTCGTTTGTTCTCGTACCCTGATACTCATCGTCACAGACTTGGACCCAATTATACCCAAATTCCCATCAATCAACCTGTCTCACGTGTGGCCAATTATCAAAGGGATGGTTTCATGACC
G
GTAAGCTTTTCTTTTCCTTCTTTGTTTGTGTATGTGTGTGTGTATATATATATTTGAGTGGATATATTCTAAAAAGGAAAACTCAAATTCACACGCACTCTCTTTTCCCCACAGTAAAT
GGCAATGGTGGTTCCAATCTTAATTATGGTCCCAATTCGTTCGATGGTCCTTACCAAAACGATATTGTTGGTTCCACTTACACTGCTGAAGAAATCTCTGGTTTCACTGGCCGATTTACA
TATGAGCTTAAAGATGTCGACTTTGTACAGGCTGGTGATTTGTACAGAGTCATGTCTCCTGAAGAAAGAACAGACTTGGTTAACAACATTGCTGGTCACTTGAAAAACGCAAAGAAGCAC
ATCCGTGATCGCCAAATTGCTCACTTCAAACGCGCTGATCGCGAGTACGGTTCGCGCATAGAAAGTGCCATTTTGGGACTCACCGCAAAAGCTTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGTCCAAGAACATCTTAACAACTTCCAATGGAAACCCCGTTGAGAATGATCAAACCTCTCAGACTGCTGGTCCCACAGGCCCAGTTCTTATCCAGGACTTCCACTTGATTGACAAACTT
G
CCCATTTTGACAGAGAACGCATCCCTGAACGCGTCGTTCATGCCAAAGGAGCTGGAGCACACGGCTATTTCGAGGTTACCCACGATATTTCCAAGCTGACAAAAGCCAAGTTCTTGAAT
GGAATTGGCAAAAAGACACCCATATTTACCCGTTTTTCTACCGTCGGTGGTGCCCAAGGAAGTGCGGACACAGCCCGCGACCCTCGTGGATTTGCTGTCAAGTTCTACACAGAAGAAG
GT
AACTGGGATATGGTTGGTAACAACACCCCAGTCTTCTTCATCCGCGATCCATCGAAATTCCCTG
ATTTTATCCACACTCAGAAGAAGAATCCAAGAACCAATCTTCCTGATGCTGATATG
TTCTGGGACTTCTTATCACTTGTCCCAGAGTCTATCCACCAAGTGTCCATTCTCTTCTCTAACCGCGGCACTCCAGATGGATTCCGTCACATGCACGGCTTCTCTTCTCACACTCTTAAG
CTAGTTGATGACAAGGGGCAGTTCAAGTATGTCAAATGGCACTTCAAGACTGACCAGGGAGTCAAGAACCTGTCGGCCAGTGAAGCTGCTAGAATTTCCGGTATCGATCCTGATTACTCT
ACACGCGATCTCTTCAACGCAATTGAACGCGGCGAACATCCTTCGTGGTCCGTCTATATTCAAATCATGGAACCTAATGACGCAAAGAGCTACCGCTTTGATCCATTTGATATCACCAAA
GTCTGGCCCCATAGT
GATTACCCTCTTGTTCCCGTTGGTAAGATGGTCTTGAACAGAAACCCTGAAAACTACTTTGCGGAGACGGAGCAAGCTGCGTTTAGTCCTTCGCACATGGTTCCT
GGTATCGATGTCAGCCCCGACCGTATGCTGCAGGGTCGTTTGTTCTCGTACCCTGATACTCATCGTCACAGACTTGGACCCAATTATACCCAAATTCCCATCAATCAACCTGTCTCACGT
GTGGCCAATTATCAAAGGGATGGTTTCATGACCG
TAAATGGCAATGGTGGTTCCAATCTTAATTATGGTCCCAATTCGTTCGATGGTCCTTACCAAAACGATATTGTTGGTTCCACTTAC
ACTGCTGAAGAAATCTCTGGTTTCACTGGCCGATTTACATATGAGCTTAAAGATGTCGACTTTGTACAGGCTGGTGATTTGTACAGAGTCATGTCTCCTGAAGAAAGAACAGACTTGGTT
AACAACATTGCTGGTCACTTGAAAAACGCAAAGAAGCACATCCGTGATCGCCAAATTGCTCACTTCAAACGCGCTGATCGCGAGTACGGTTCGCGCATAGAAAGTGCCATTTTGGGACTC
ACCGCAAAAGCTTAA

Retrieve as FASTA